PDB entry 6ahi

View 6ahi on RCSB PDB site
Description: Crystal structure of O-acetylserine dependent cystathionine beta-synthase from Helicobacter pylori.
Class: transferase
Keywords: transferase
Deposited on 2018-08-19, released 2018-09-05
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-09-05, with a file datestamp of 2018-08-31.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: N/A
AEROSPACI score: 0.34 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Cysteine synthase
    Species: Helicobacter pylori (strain ATCC 700392 / 26695) [TaxId:85962]
    Gene: cysM, cysK, HP_0107
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6ahia_
  • Chain 'B':
    Compound: Cysteine synthase
    Species: Helicobacter pylori (strain ATCC 700392 / 26695) [TaxId:85962]
    Gene: cysM, cysK, HP_0107
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6ahib_
  • Heterogens: MET, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6ahiA (A:)
    mmiittmqdaigrtpvfkftnkdypiplnsaiyaklehlnpggsvkdrlgqyligegfkt
    gkitskttiieptagntgialalvaikhhlktifvvpekfstekqqimralgalvintpt
    segisgaikkskelaesipdsylplqfenpdnpaayyhtlapeivqelgtnltsfvagig
    sggtfagtarylkeripairligvepegsilnggepgpheiegigvefippffenldidg
    fetisdeegfsytrklakkngllvgsssgaafvaalkeaqrlpegsqvltifpdvadryl
    skgiyllqhhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >6ahiA (A:)
    mmiittmqdaigrtpvfkftnkdypiplnsaiyaklehlnpggsvkdrlgqyligegfkt
    gkitskttiieptagntgialalvaikhhlktifvvpekfstekqqimralgalvintpt
    segisgaikkskelaesipdsylplqfenpdnpaayyhtlapeivqelgtnltsfvagig
    sggtfagtarylkeripairligvepegsilnggepgpheiegigvefippffenldidg
    fetisdeegfsytrklakkngllvgsssgaafvaalkeaqrlpegsqvltifpdvadryl
    skgiyl
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >6ahiB (B:)
    mmiittmqdaigrtpvfkftnkdypiplnsaiyaklehlnpggsvkdrlgqyligegfkt
    gkitskttiieptagntgialalvaikhhlktifvvpekfstekqqimralgalvintpt
    segisgaikkskelaesipdsylplqfenpdnpaayyhtlapeivqelgtnltsfvagig
    sggtfagtarylkeripairligvepegsilnggepgpheiegigvefippffenldidg
    fetisdeegfsytrklakkngllvgsssgaafvaalkeaqrlpegsqvltifpdvadryl
    skgiyllqhhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >6ahiB (B:)
    mmiittmqdaigrtpvfkftnkdypiplnsaiyaklehlnpggsvkdrlgqyligegfkt
    gkitskttiieptagntgialalvaikhhlktifvvpekfstekqqimralgalvintpt
    segisgaikkskelaesipdsylplqfenpdnpaayyhtlapeivqelgtnltsfvagig
    sggtfagtarylkeripairligvepegsilnggepgpheiegigvefippffenldidg
    fetisdeegfsytrklakkngllvgsssgaafvaalkeaqrlpegsqvltifpdvadryl
    skgiyl