PDB entry 6agq

View 6agq on RCSB PDB site
Description: Acetyl xylan esterase from Paenibacillus sp. R4
Class: hydrolase
Keywords: Paenibacillus sp., Acetyl esterase, acetyl xylan esterases, HYDROLASE
Deposited on 2018-08-13, released 2018-10-10
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-10-10, with a file datestamp of 2018-10-05.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: N/A
AEROSPACI score: 0.28 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: acetyl xylan esterase
    Species: Paenibacillus sp. R4 [TaxId:1079050]
    Database cross-references and differences (RAF-indexed):
    • PDB 6AGQ (Start-320)
    Domains in SCOPe 2.07: d6agqa_
  • Chain 'B':
    Compound: acetyl xylan esterase
    Species: Paenibacillus sp. R4 [TaxId:1079050]
    Database cross-references and differences (RAF-indexed):
    • PDB 6AGQ (Start-320)
    Domains in SCOPe 2.07: d6agqb_
  • Chain 'C':
    Compound: acetyl xylan esterase
    Species: Paenibacillus sp. R4 [TaxId:1079050]
    Database cross-references and differences (RAF-indexed):
    • PDB 6AGQ (Start-320)
    Domains in SCOPe 2.07: d6agqc_
  • Chain 'D':
    Compound: acetyl xylan esterase
    Species: Paenibacillus sp. R4 [TaxId:1079050]
    Database cross-references and differences (RAF-indexed):
    • PDB 6AGQ (Start-320)
    Domains in SCOPe 2.07: d6agqd_
  • Chain 'E':
    Compound: acetyl xylan esterase
    Species: Paenibacillus sp. R4 [TaxId:1079050]
    Database cross-references and differences (RAF-indexed):
    • PDB 6AGQ (Start-320)
    Domains in SCOPe 2.07: d6agqe_
  • Chain 'F':
    Compound: acetyl xylan esterase
    Species: Paenibacillus sp. R4 [TaxId:1079050]
    Database cross-references and differences (RAF-indexed):
    • PDB 6AGQ (Start-320)
    Domains in SCOPe 2.07: d6agqf_
  • Heterogens: ZN, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6agqA (A:)
    mpnvdmplsqlqdykpeltnetdfdlfwdnakalsnqkplhaqvnlvqdyplksisiydv
    vydgadgtpihgwyvtpkgehqpgslpvlvkyhgysgnrgypnellqwasmgmaalaidv
    rgqggvtpdraeypqggipgwmtlgildpasyyykqvyldciraldfvcsreevdasria
    vyggsqggglalaaagldsrpklalpvfpflchfrrsveihasgpyveiknwfrrydpeh
    rqeeqvyrtlsyfdgmnmasrikartlmaitlqditcppstcfaaynhlagpkevrlyhd
    ygheglpfheeammrfieayl
    

    Sequence, based on observed residues (ATOM records): (download)
    >6agqA (A:)
    mplsqlqdykpeltnetdfdlfwdnakalsnqkplhaqvnlvqdyplksisiydvvydga
    dgtpihgwyvtpkgehqpgslpvlvkyhgysgnrgypnellqwasmgmaalaidvrgqgg
    vtpdraeypqggipgwmtlgildpasyyykqvyldciraldfvcsreevdasriavyggs
    qggglalaaagldsrpklalpvfpflchfrrsveihasgpyveiknwfrrydpehrqeeq
    vyrtlsyfdgmnmasrikartlmaitlqditcppstcfaaynhlagpkevrlyhdygheg
    lpfheeammrfieayl
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >6agqB (B:)
    mpnvdmplsqlqdykpeltnetdfdlfwdnakalsnqkplhaqvnlvqdyplksisiydv
    vydgadgtpihgwyvtpkgehqpgslpvlvkyhgysgnrgypnellqwasmgmaalaidv
    rgqggvtpdraeypqggipgwmtlgildpasyyykqvyldciraldfvcsreevdasria
    vyggsqggglalaaagldsrpklalpvfpflchfrrsveihasgpyveiknwfrrydpeh
    rqeeqvyrtlsyfdgmnmasrikartlmaitlqditcppstcfaaynhlagpkevrlyhd
    ygheglpfheeammrfieayl
    

    Sequence, based on observed residues (ATOM records): (download)
    >6agqB (B:)
    mplsqlqdykpeltnetdfdlfwdnakalsnqkplhaqvnlvqdyplksisiydvvydga
    dgtpihgwyvtpkgehqpgslpvlvkyhgysgnrgypnellqwasmgmaalaidvrgqgg
    vtpdraeypqggipgwmtlgildpasyyykqvyldciraldfvcsreevdasriavyggs
    qggglalaaagldsrpklalpvfpflchfrrsveihasgpyveiknwfrrydpehrqeeq
    vyrtlsyfdgmnmasrikartlmaitlqditcppstcfaaynhlagpkevrlyhdygheg
    lpfheeammrfieayl
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >6agqC (C:)
    mpnvdmplsqlqdykpeltnetdfdlfwdnakalsnqkplhaqvnlvqdyplksisiydv
    vydgadgtpihgwyvtpkgehqpgslpvlvkyhgysgnrgypnellqwasmgmaalaidv
    rgqggvtpdraeypqggipgwmtlgildpasyyykqvyldciraldfvcsreevdasria
    vyggsqggglalaaagldsrpklalpvfpflchfrrsveihasgpyveiknwfrrydpeh
    rqeeqvyrtlsyfdgmnmasrikartlmaitlqditcppstcfaaynhlagpkevrlyhd
    ygheglpfheeammrfieayl
    

    Sequence, based on observed residues (ATOM records): (download)
    >6agqC (C:)
    mplsqlqdykpeltnetdfdlfwdnakalsnqkplhaqvnlvqdyplksisiydvvydga
    dgtpihgwyvtpkgehqpgslpvlvkyhgysgnrgypnellqwasmgmaalaidvrgqgg
    vtpdraeypqggipgwmtlgildpasyyykqvyldciraldfvcsreevdasriavyggs
    qggglalaaagldsrpklalpvfpflchfrrsveihasgpyveiknwfrrydpehrqeeq
    vyrtlsyfdgmnmasrikartlmaitlqditcppstcfaaynhlagpkevrlyhdygheg
    lpfheeammrfieayl
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >6agqD (D:)
    mpnvdmplsqlqdykpeltnetdfdlfwdnakalsnqkplhaqvnlvqdyplksisiydv
    vydgadgtpihgwyvtpkgehqpgslpvlvkyhgysgnrgypnellqwasmgmaalaidv
    rgqggvtpdraeypqggipgwmtlgildpasyyykqvyldciraldfvcsreevdasria
    vyggsqggglalaaagldsrpklalpvfpflchfrrsveihasgpyveiknwfrrydpeh
    rqeeqvyrtlsyfdgmnmasrikartlmaitlqditcppstcfaaynhlagpkevrlyhd
    ygheglpfheeammrfieayl
    

    Sequence, based on observed residues (ATOM records): (download)
    >6agqD (D:)
    mplsqlqdykpeltnetdfdlfwdnakalsnqkplhaqvnlvqdyplksisiydvvydga
    dgtpihgwyvtpkgehqpgslpvlvkyhgysgnrgypnellqwasmgmaalaidvrgqgg
    vtpdraeypqggipgwmtlgildpasyyykqvyldciraldfvcsreevdasriavyggs
    qggglalaaagldsrpklalpvfpflchfrrsveihasgpyveiknwfrrydpehrqeeq
    vyrtlsyfdgmnmasrikartlmaitlqditcppstcfaaynhlagpkevrlyhdygheg
    lpfheeammrfieayl
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >6agqE (E:)
    mpnvdmplsqlqdykpeltnetdfdlfwdnakalsnqkplhaqvnlvqdyplksisiydv
    vydgadgtpihgwyvtpkgehqpgslpvlvkyhgysgnrgypnellqwasmgmaalaidv
    rgqggvtpdraeypqggipgwmtlgildpasyyykqvyldciraldfvcsreevdasria
    vyggsqggglalaaagldsrpklalpvfpflchfrrsveihasgpyveiknwfrrydpeh
    rqeeqvyrtlsyfdgmnmasrikartlmaitlqditcppstcfaaynhlagpkevrlyhd
    ygheglpfheeammrfieayl
    

    Sequence, based on observed residues (ATOM records): (download)
    >6agqE (E:)
    mplsqlqdykpeltnetdfdlfwdnakalsnqkplhaqvnlvqdyplksisiydvvydga
    dgtpihgwyvtpkgehqpgslpvlvkyhgysgnrgypnellqwasmgmaalaidvrgqgg
    vtpdraeypqggipgwmtlgildpasyyykqvyldciraldfvcsreevdasriavyggs
    qggglalaaagldsrpklalpvfpflchfrrsveihasgpyveiknwfrrydpehrqeeq
    vyrtlsyfdgmnmasrikartlmaitlqditcppstcfaaynhlagpkevrlyhdygheg
    lpfheeammrfieayl
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >6agqF (F:)
    mpnvdmplsqlqdykpeltnetdfdlfwdnakalsnqkplhaqvnlvqdyplksisiydv
    vydgadgtpihgwyvtpkgehqpgslpvlvkyhgysgnrgypnellqwasmgmaalaidv
    rgqggvtpdraeypqggipgwmtlgildpasyyykqvyldciraldfvcsreevdasria
    vyggsqggglalaaagldsrpklalpvfpflchfrrsveihasgpyveiknwfrrydpeh
    rqeeqvyrtlsyfdgmnmasrikartlmaitlqditcppstcfaaynhlagpkevrlyhd
    ygheglpfheeammrfieayl
    

    Sequence, based on observed residues (ATOM records): (download)
    >6agqF (F:)
    mplsqlqdykpeltnetdfdlfwdnakalsnqkplhaqvnlvqdyplksisiydvvydga
    dgtpihgwyvtpkgehqpgslpvlvkyhgysgnrgypnellqwasmgmaalaidvrgqgg
    vtpdraeypqggipgwmtlgildpasyyykqvyldciraldfvcsreevdasriavyggs
    qggglalaaagldsrpklalpvfpflchfrrsveihasgpyveiknwfrrydpehrqeeq
    vyrtlsyfdgmnmasrikartlmaitlqditcppstcfaaynhlagpkevrlyhdygheg
    lpfheeammrfieayl