PDB entry 6ae3

View 6ae3 on RCSB PDB site
Description: Crystal structure of GSK3beta complexed with Morin
Class: signaling protein
Keywords: Kinase, Flavonoid, SIGNALING PROTEIN
Deposited on 2018-08-03, released 2018-09-19
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-09-19, with a file datestamp of 2018-09-14.
Experiment type: XRAY
Resolution: 2.14 Å
R-factor: N/A
AEROSPACI score: 0.28 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Glycogen synthase kinase-3 beta
    Species: Mus musculus [TaxId:10090]
    Gene: GSK3B
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6ae3a_
  • Chain 'B':
    Compound: Glycogen synthase kinase-3 beta
    Species: Mus musculus [TaxId:10090]
    Gene: GSK3B
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6ae3b_
  • Chain 'C':
    Compound: Glycogen synthase kinase-3 beta
    Species: Mus musculus [TaxId:10090]
    Gene: GSK3B
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6ae3c_
  • Chain 'D':
    Compound: Glycogen synthase kinase-3 beta
    Species: Mus musculus [TaxId:10090]
    Gene: GSK3B
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6ae3d_
  • Heterogens: MRI, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6ae3A (A:)
    msgrprttsfaesckpvqqpsafgsmkvsrdkdgskvttvvatpgqgpdrpqevsytdtk
    vigngsfgvvyqaklcdsgelvaikkvlqdkrfknrelqimrkldhcnivrlryffyssg
    ekkdevylnlvldyvpetvyrvarhysrakqtlpviyvklymyqlfrslayihsfgichr
    dikpqnllldpdtavlklcdfgsakqlvrgepnvsyicsryyrapelifgatdytssidv
    wsagcvlaelllgqpifpgdsgvdqlveiikvlgtptreqiremnpnytefkfpqikahp
    wtkvfrprtppeaialcsrlleytptarltpleacahsffdelrdpnvklpngrdtpalf
    nfttqelssnpplatilipphariqaaasppanataasdtnagdrgqtnnaasasasnst
    

    Sequence, based on observed residues (ATOM records): (download)
    >6ae3A (A:)
    kvttvvatpgqgpdrpqevsytdtkvigngsfgvvyqaklcdsgelvaikkvlqrfknre
    lqimrkldhcnivrlryffyssgkkdevylnlvldyvpetvyrvarhysrakqtlpviyv
    klymyqlfrslayihsfgichrdikpqnllldpdtavlklcdfgsakqlvrgepnvsyic
    sryyrapelifgatdytssidvwsagcvlaelllgqpifpgdsgvdqlveiikvlgtptr
    eqiremnpnytekfpqikahpwtkvfrprtppeaialcsrlleytptarltpleacahsf
    fdelrdpnvklpngrdtpalfnfttqelssnpplatilipphariqaa
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >6ae3B (B:)
    msgrprttsfaesckpvqqpsafgsmkvsrdkdgskvttvvatpgqgpdrpqevsytdtk
    vigngsfgvvyqaklcdsgelvaikkvlqdkrfknrelqimrkldhcnivrlryffyssg
    ekkdevylnlvldyvpetvyrvarhysrakqtlpviyvklymyqlfrslayihsfgichr
    dikpqnllldpdtavlklcdfgsakqlvrgepnvsyicsryyrapelifgatdytssidv
    wsagcvlaelllgqpifpgdsgvdqlveiikvlgtptreqiremnpnytefkfpqikahp
    wtkvfrprtppeaialcsrlleytptarltpleacahsffdelrdpnvklpngrdtpalf
    nfttqelssnpplatilipphariqaaasppanataasdtnagdrgqtnnaasasasnst
    

    Sequence, based on observed residues (ATOM records): (download)
    >6ae3B (B:)
    kvttvvatpgqgpdrpqevsytdtkvigngsfgvvyqaklcdsgelvaikkvlqdfknre
    lqimrkldhcnivrlryffyssekkdevylnlvldyvpetvyrvarhysrakqtlpviyv
    klymyqlfrslayihsfgichrdikpqnllldpdtavlklcdfgsakqlvrgepnvsyic
    sryyrapelifgatdytssidvwsagcvlaelllgqpifpgdsgvdqlveiikvlgtptr
    eqiremnpnyfkfpqikahpwtkvfrprtppeaialcsrlleytptarltpleacahsff
    delrdpnvklpngrdtpalfnfttqelssnpplatilipphari
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >6ae3C (C:)
    msgrprttsfaesckpvqqpsafgsmkvsrdkdgskvttvvatpgqgpdrpqevsytdtk
    vigngsfgvvyqaklcdsgelvaikkvlqdkrfknrelqimrkldhcnivrlryffyssg
    ekkdevylnlvldyvpetvyrvarhysrakqtlpviyvklymyqlfrslayihsfgichr
    dikpqnllldpdtavlklcdfgsakqlvrgepnvsyicsryyrapelifgatdytssidv
    wsagcvlaelllgqpifpgdsgvdqlveiikvlgtptreqiremnpnytefkfpqikahp
    wtkvfrprtppeaialcsrlleytptarltpleacahsffdelrdpnvklpngrdtpalf
    nfttqelssnpplatilipphariqaaasppanataasdtnagdrgqtnnaasasasnst
    

    Sequence, based on observed residues (ATOM records): (download)
    >6ae3C (C:)
    vttvvatpgqpdrpqevsytdtkvigngsfgvvyqaklcdsgelvaikkvlqdkrknrel
    qimrkldhcnivrlryffyskdevylnlvldyvpetvyrvarhysrakqtlpviyvklym
    yqlfrslayihsfgichrdikpqnllldpdtavlklcdfgsakqlvrgepnvsyicsryy
    rapelifgatdytssidvwsagcvlaelllgqpifpgdsgvdqlveiikvlgtptreqir
    emnqikahpwtkvfrprtppeaialcsrlleytptarltpleacahsffdelrdpnvklp
    ngrdtpalfnfttqelssnpplatilipphar
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >6ae3D (D:)
    msgrprttsfaesckpvqqpsafgsmkvsrdkdgskvttvvatpgqgpdrpqevsytdtk
    vigngsfgvvyqaklcdsgelvaikkvlqdkrfknrelqimrkldhcnivrlryffyssg
    ekkdevylnlvldyvpetvyrvarhysrakqtlpviyvklymyqlfrslayihsfgichr
    dikpqnllldpdtavlklcdfgsakqlvrgepnvsyicsryyrapelifgatdytssidv
    wsagcvlaelllgqpifpgdsgvdqlveiikvlgtptreqiremnpnytefkfpqikahp
    wtkvfrprtppeaialcsrlleytptarltpleacahsffdelrdpnvklpngrdtpalf
    nfttqelssnpplatilipphariqaaasppanataasdtnagdrgqtnnaasasasnst
    

    Sequence, based on observed residues (ATOM records): (download)
    >6ae3D (D:)
    kvttvvatpgqgpdrpqevsytdtkvigngsfgvvyqaklcdsgelvaikkvlqnrelqi
    mrkldhcnivrlryffysvylnlvldyvpetvyrvarhysrakqtlpviyvklymyqlfr
    slayihsfgichrdikpqnllldpdtavlklcdfgsakqlvrgepnvsyicsryyrapel
    ifgatdytssidvwsagcvlaelllgqpifpgdsgvdqlveiikvlgtptreqiremnpn
    yteffpqikahpwtkvfrprtppeaialcsrlleytptarltpleacahsffdelrdpnv
    klpnrdtpalfnfttqelssnpplatilippha