PDB entry 6ads

View 6ads on RCSB PDB site
Description: Structure of Seneca Valley Virus in acidic conditions
Class: virus
Keywords: Seneca Valley virus, VIRUS
Deposited on 2018-08-02, released 2019-02-06
The last revision prior to the SCOPe 2.07 freeze date was dated 2019-02-06, with a file datestamp of 2019-02-01.
Experiment type: EM
Resolution: 2.84 Å
R-factor: N/A
AEROSPACI score: 0.16 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: vp1
    Species: Seneca valley virus [TaxId:390157]
    Database cross-references and differences (RAF-indexed):
    • PDB 6ADS (0-257)
    Domains in SCOPe 2.07: d6adsa_
  • Chain 'B':
    Compound: vp2
    Species: Seneca valley virus [TaxId:390157]
    Database cross-references and differences (RAF-indexed):
    • PDB 6ADS (0-266)
  • Chain 'C':
    Compound: vp3
    Species: Seneca valley virus [TaxId:390157]
    Database cross-references and differences (RAF-indexed):
    • PDB 6ADS (Start-230)
    Domains in SCOPe 2.07: d6adsc_
  • Chain 'D':
    Compound: vp4
    Species: Seneca valley virus [TaxId:390157]
    Database cross-references and differences (RAF-indexed):
    • PDB 6ADS (Start-70)

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6adsA (A:)
    stdnaetgvieagntdtdfsgelaapgsnhtnvkflfdrsrllnvikvlekdavfprpfp
    tatgtqqddgyfclltprptvasrpatrfglyvspsdsgvlantsldfnfyslacftyfr
    sdlevtvvslepdlefavgwfpsgseyqassfvydqlhvpyhftgrtprafaskggkvsf
    vlpwnsvssvlpvrwggasklssatrglpahadwgtiyafiprpnekkstavkhvavyir
    yknarawcpsmlpfrsyk
    

    Sequence, based on observed residues (ATOM records): (download)
    >6adsA (A:)
    stdnaetgvieagntdtdfsgelaapgsnhtnvkflfdrsrllnvikvlekdavfprpfp
    tatgtqqddgyfclltprptvasrpatrfglygvlantsldfnfyslacftyfrsdlevt
    vvslepdlefavgwfpsgseyqassfvydqlhvpyhftgrtprafaskggkvsfvlpwns
    vssvlpvrwggasklssatrglpahadwgtiyafiprpnekkstavkhvavyiryknara
    wcpsmlpfrsyk
    

  • Chain 'B':
    No sequence available.

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >6adsC (C:)
    gpiptaprenslmflsttpddtvpaygnvrtppvnylpgeitdllqlariptlmafgrvd
    ayvpyvavptqfddkplisfpitlsdpvyqntlvgaissnfanyrgciqitltfcgpmma
    rgkfllsysppngtqpqtlseamqctysiwdiglnsswtfvipyispsdyretraitnsv
    ysadgwfslhkltkitlppdcpqspcilffasagedytlrlpvdcnpsyvf
    

    Sequence, based on observed residues (ATOM records): (download)
    >6adsC (C:)
    piptaprenslmflsttpddtvpaygnvrtppvnylpgeitdllqlariptlmafgrayv
    pyvavptqfddkplisfpitlsdpvyqntlvgaissnfanyrgciqitltfcgpmmargk
    fllsysppngtqpqtlseamqctysiwdiglnsswtfvipyispsdyretraitnsvysa
    dgwfslhkltkitlppdcpqspcilffasagedytlrlpvdcnpsyvf
    

  • Chain 'D':
    No sequence available.