PDB entry 6adl

View 6adl on RCSB PDB site
Description: Anthrax Toxin Receptor 1-bound spent particles of Seneca Valley Virus in acidic conditions
Class: virus
Keywords: Seneca Valley virus, VIRUS
Deposited on 2018-08-01, released 2019-12-25
The last revision prior to the SCOPe 2.07 freeze date was dated 2019-12-25, with a file datestamp of 2019-12-20.
Experiment type: EM
Resolution: 3.08 Å
R-factor: N/A
AEROSPACI score: 0.14 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: vp1
    Species: Senecavirus A [TaxId:390157]
    Database cross-references and differences (RAF-indexed):
    • PDB 6ADL (0-229)
  • Chain 'B':
    Compound: vp2
    Species: Senecavirus A [TaxId:390157]
    Database cross-references and differences (RAF-indexed):
    • PDB 6ADL (0-245)
  • Chain 'C':
    Compound: vp3
    Species: Senecavirus A [TaxId:390157]
    Database cross-references and differences (RAF-indexed):
    • PDB 6ADL (0-237)
    Domains in SCOPe 2.07: d6adlc_
  • Chain 'R':
    Compound: Anthrax toxin receptor 1
    Species: Homo sapiens [TaxId:9606]
    Gene: ANTXR1
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9H6X2 (2-184)
      • expression tag (0-1)
      • engineered mutation (141)
    Domains in SCOPe 2.07: d6adlr1, d6adlr2
  • Heterogens: MG

PDB Chain Sequences:

  • Chain 'A':
    No sequence available.

  • Chain 'B':
    No sequence available.

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >6adlC (C:)
    gpiptaprenslmflsttpddtvpaygnvrtppvnylpgeitdllqlariptlmafgrvp
    epepasdayvpyvavptqfddkplisfpitlsdpvyqntlvgaissnfanyrgciqitlt
    fcgpmmargkfllsysppngtqpqtlseamqctysiwdiglnsswtfvipyispsdyret
    raitnsvysadgwfslhkltkitlppdcpqspcilffasagedytlrlpvdcnpsyvf
    

    Sequence, based on observed residues (ATOM records): (download)
    >6adlC (C:)
    gpiptaprenslmflsttpddtvpaygnvrtppvnylpgeitdllqlariptlmafgrda
    yvpyvavptqfddkplisfpitlsdpvyqntlvgaissnfanyrgciqitltfcgpmmar
    gkfllsysppngtqpqtlseamqctysiwdiglnsswtfvipyispsdyretraitnsvy
    sadgwfslhkltkitlppdcpqspcilffasagedytlrlpvdcnpsyvf
    

  • Chain 'R':
    Sequence; same for both SEQRES and ATOM records: (download)
    >6adlR (R:)
    smacyggfdlyfildksgsvlhhwneiyyfveqlahkfispqlrmsfivfstrgttlmkl
    tedreqirqgleelqkvlpggdtymhegferaseqiyyenrqgyrtasviialtdgelhe
    dlffysereanrsrdlgaivyavgvkdfnetqlariadskdhvfpvndgfqalqgiihsi
    lkksc