PDB entry 6adi

View 6adi on RCSB PDB site
Description: Crystal Structures of IDH2 R140Q in complex with AG-881
Class: oxidoreductase
Keywords: Oxidoreductase
Deposited on 2018-08-01, released 2018-09-05
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-09-05, with a file datestamp of 2018-08-31.
Experiment type: XRAY
Resolution: 1.97 Å
R-factor: N/A
AEROSPACI score: 0.31 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Isocitrate dehydrogenase [NADP], mitochondrial
    Species: Homo sapiens [TaxId:9606]
    Gene: IDH2
    Database cross-references and differences (RAF-indexed):
    • Uniprot P48735 (1-412)
      • engineered mutation (100)
      • expression tag (413-418)
    Domains in SCOPe 2.07: d6adia1, d6adia2
  • Chain 'B':
    Compound: Isocitrate dehydrogenase [NADP], mitochondrial
    Species: Homo sapiens [TaxId:9606]
    Gene: IDH2
    Database cross-references and differences (RAF-indexed):
    • Uniprot P48735
      • engineered mutation (100)
    Domains in SCOPe 2.07: d6adib_
  • Heterogens: 9UO, NDP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6adiA (A:)
    mdkrikvakpvvemdgdemtriiwqfikeklilphvdiqlkyfdlglpnrdqtddqvtid
    salatqkysvavkcatitpdearveefklkkmwkspngtiqnilggtvfrepiicknipr
    lvpgwtkpitigrhahgdqykatdfvadragtfkmvftpkdgsgvkewevynfpaggvgm
    gmyntdesisgfahscfqyaiqkkwplymstkntilkaydgrfkdifqeifdkhyktdfd
    knkiwyehrliddmvaqvlkssggfvwacknydgdvqsdilaqgfgslglmtsvlvcpdg
    ktieaeaahgtvtrhyrehqkgrptstnpiasifawtrglehrgkldgnqdlirfaqmle
    kvcvetvesgamtkdlagcihglsnvklnehflnttdfldtiksnldralgrqhhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >6adiA (A:)
    dkrikvakpvvemdgdemtriiwqfikeklilphvdiqlkyfdlglpnrdqtddqvtids
    alatqkysvavkcatitpdearveefklkkmwkspngtiqnilggtvfrepiickniprl
    vpgwtkpitigrhahgdqykatdfvadragtfkmvftpkdgsgvkewevynfpaggvgmg
    myntdesisgfahscfqyaiqkkwplymstkntilkaydgrfkdifqeifdkhyktdfdk
    nkiwyehrliddmvaqvlkssggfvwacknydgdvqsdilaqgfgslglmtsvlvcpdgk
    tieaeaahgtvtrhyrehqkgrptstnpiasifawtrglehrgkldgnqdlirfaqmlek
    vcvetvesgamtkdlagcihglsnvklnehflnttdfldtiksnldralgrqhhhhhh
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >6adiB (B:)
    mdkrikvakpvvemdgdemtriiwqfikeklilphvdiqlkyfdlglpnrdqtddqvtid
    salatqkysvavkcatitpdearveefklkkmwkspngtiqnilggtvfrepiicknipr
    lvpgwtkpitigrhahgdqykatdfvadragtfkmvftpkdgsgvkewevynfpaggvgm
    gmyntdesisgfahscfqyaiqkkwplymstkntilkaydgrfkdifqeifdkhyktdfd
    knkiwyehrliddmvaqvlkssggfvwacknydgdvqsdilaqgfgslglmtsvlvcpdg
    ktieaeaahgtvtrhyrehqkgrptstnpiasifawtrglehrgkldgnqdlirfaqmle
    kvcvetvesgamtkdlagcihglsnvklnehflnttdfldtiksnldralgrqhhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >6adiB (B:)
    rikvakpvvemdgdemtriiwqfikeklilphvdiqlkyfdlglpnrdqtddqvtidsal
    atqkysvavkcatitpdearveefklkkmwkspngtiqnilggtvfrepiickniprlvp
    gwtkpitigrhahgdqykatdfvadragtfkmvftpkdgsgvkewevynfpaggvgmgmy
    ntdesisgfahscfqyaiqkkwplymstkntilkaydgrfkdifqeifdkhyktdfdknk
    iwyehrliddmvaqvlkssggfvwacknydgdvqsdilaqgfgslglmtsvlvcpdgkti
    eaeaahgtvtrhyrehqkgrptstnpiasifawtrglehrgkldgnqdlirfaqmlekvc
    vetvesgamtkdlagcihglsnvklnehflnttdfldtiksnldral