PDB entry 6adg

View 6adg on RCSB PDB site
Description: Crystal Structures of IDH1 R132H in complex with AG-881
Class: oxidoreductase
Keywords: idh1, oxidoreductase
Deposited on 2018-08-01, released 2018-09-05
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-09-05, with a file datestamp of 2018-08-31.
Experiment type: XRAY
Resolution: 3 Å
R-factor: N/A
AEROSPACI score: 0.13 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: isocitrate dehydrogenase [nadp] cytoplasmic
    Species: Homo sapiens [TaxId:9606]
    Gene: IDH1
    Database cross-references and differences (RAF-indexed):
    • Uniprot O75874 (Start-413)
      • engineered mutation (131)
    Domains in SCOPe 2.07: d6adga_
  • Chain 'B':
    Compound: isocitrate dehydrogenase [nadp] cytoplasmic
    Species: Homo sapiens [TaxId:9606]
    Gene: IDH1
    Database cross-references and differences (RAF-indexed):
    • Uniprot O75874
      • engineered mutation (131)
    Domains in SCOPe 2.07: d6adgb_
  • Chain 'C':
    Compound: isocitrate dehydrogenase [nadp] cytoplasmic
    Species: Homo sapiens [TaxId:9606]
    Gene: IDH1
    Database cross-references and differences (RAF-indexed):
    • Uniprot O75874
      • engineered mutation (131)
    Domains in SCOPe 2.07: d6adgc_
  • Heterogens: NDP, MG, 9UO, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6adgA (A:)
    mskkisggsvvemqgdemtriiwelikeklifpyveldlhsydlgienrdatndqvtkda
    aeaikkhnvgvkcatitpdekrveefklkqmwkspngtirnilggtvfreaiickniprl
    vsgwvkpiiighhaygdqyratdfvvpgpgkveitytpsdgtqkvtylvhnfeegggvam
    gmynqdksiedfahssfqmalskgwplylstkntilkkydgrfkdifqeiydkqyksqfe
    aqkiwyehrliddmvaqamkseggfiwacknydgdvqsdsvaqgygslgmmtsvlvcpdg
    ktveaeaahgtvtrhyrmyqkgqetstnpiasifawtrglahrakldnnkelaffanale
    evsietieagfmtkdlaacikglpnvqrsdylntfefmdklgenlkiklaqaklslehhh
    hhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >6adgA (A:)
    kkisggsvvemqgdemtriiwelikeklifpyveldlhsydlgienrdatndqvtkdaae
    aikkhnvgvkcatitpdekrveefklkqmwkspngtirnilggtvfreaiickniprlvs
    gwvkpiiighhaygdqyratdfvvpgpgkveitytpsdgtqkvtylvhnfeegggvamgm
    ynqdksiedfahssfqmalskgwplylstkntilkkydgrfkdifqeiydkqyksqfeaq
    kiwyehrliddmvaqamkseggfiwacknydgdvqsdsvaqgygslgmmtsvlvcpdgkt
    veaeaahgtvtrhyrmyqkgqetstnpiasifawtrglahrakldnnkelaffanaleev
    sietieagfmtkdlaacikglpnvqrsdylntfefmdklgenlkiklaqakl
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >6adgB (B:)
    mskkisggsvvemqgdemtriiwelikeklifpyveldlhsydlgienrdatndqvtkda
    aeaikkhnvgvkcatitpdekrveefklkqmwkspngtirnilggtvfreaiickniprl
    vsgwvkpiiighhaygdqyratdfvvpgpgkveitytpsdgtqkvtylvhnfeegggvam
    gmynqdksiedfahssfqmalskgwplylstkntilkkydgrfkdifqeiydkqyksqfe
    aqkiwyehrliddmvaqamkseggfiwacknydgdvqsdsvaqgygslgmmtsvlvcpdg
    ktveaeaahgtvtrhyrmyqkgqetstnpiasifawtrglahrakldnnkelaffanale
    evsietieagfmtkdlaacikglpnvqrsdylntfefmdklgenlkiklaqaklslehhh
    hhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >6adgB (B:)
    kkisggsvvemqgdemtriiwelikeklifpyveldlhsydlgienrdatndqvtkdaae
    aikkhnvgvkcatitpdekrveefklkqmwkspngtirnilggtvfreaiickniprlvs
    gwvkpiiighhaygdqyratdfvvpgpgkveitytpsdgtqkvtylvhnfeegggvamgm
    ynqdksiedfahssfqmalskgwplylstkntilkkydgrfkdifqeiydkqyksqfeaq
    kiwyehrliddmvaqamkseggfiwacknydgdvqsdsvaqgygslgmmtsvlvcpdgkt
    veaeaahgtvtrhyrmyqkgqetstnpiasifawtrglahrakldnnkelaffanaleev
    sietieagfmtkdlaacikglpnvqrsdylntfefmdklgenlkiklaqak
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >6adgC (C:)
    mskkisggsvvemqgdemtriiwelikeklifpyveldlhsydlgienrdatndqvtkda
    aeaikkhnvgvkcatitpdekrveefklkqmwkspngtirnilggtvfreaiickniprl
    vsgwvkpiiighhaygdqyratdfvvpgpgkveitytpsdgtqkvtylvhnfeegggvam
    gmynqdksiedfahssfqmalskgwplylstkntilkkydgrfkdifqeiydkqyksqfe
    aqkiwyehrliddmvaqamkseggfiwacknydgdvqsdsvaqgygslgmmtsvlvcpdg
    ktveaeaahgtvtrhyrmyqkgqetstnpiasifawtrglahrakldnnkelaffanale
    evsietieagfmtkdlaacikglpnvqrsdylntfefmdklgenlkiklaqaklslehhh
    hhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >6adgC (C:)
    kkisggsvvemqgdemtriiwelikeklifpyveldlhsydlgienrdatndqvtkdaae
    aikkhnvgvkcangtirnilggtvfreaiickniprlvsgwvkpiiighhaygdqyratd
    fvvpgpgkveitytpsdgtqkvtylvhnfeegggvamgmynqdksiedfahssfqmalsk
    gwplylstkntilkkydgrfkdifqeiydkqyksqfeaqkiwyehrliddmvaqamkseg
    gfiwacknydgdvqsdsvaqgygslgmmtsvlvcpdgktveaeaahgtvtrhyrmyqkgq
    etstnpiasifawtrglahrakldnnkelaffanaleevsietieagfmtkdlaacikgl
    pnvqrsdylntfefmdklgenlkiklaqak