PDB entry 6acq

View 6acq on RCSB PDB site
Description: Crystal structure of (S)-3-hydroxybutyryl-CoA dehydrogenase from Clostridium acetobutylicum, apo form
Class: oxidoreductase
Keywords: Rossmann fold, OXIDOREDUCTASE
Deposited on 2018-07-27, released 2018-11-07
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-11-07, with a file datestamp of 2018-11-02.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: N/A
AEROSPACI score: 0.2 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: 3-hydroxybutyryl-CoA dehydrogenase
    Species: Clostridium acetobutylicum [TaxId:272562]
    Gene: hbd, CA_C2708
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6acqa1, d6acqa2
  • Chain 'B':
    Compound: 3-hydroxybutyryl-CoA dehydrogenase
    Species: Clostridium acetobutylicum [TaxId:272562]
    Gene: hbd, CA_C2708
    Database cross-references and differences (RAF-indexed):
    • Uniprot P52041 (20-End)
      • expression tag (11-19)
    Domains in SCOPe 2.07: d6acqb1, d6acqb2, d6acqb3
  • Chain 'C':
    Compound: 3-hydroxybutyryl-CoA dehydrogenase
    Species: Clostridium acetobutylicum [TaxId:272562]
    Gene: hbd, CA_C2708
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6acqc1, d6acqc2
  • Chain 'D':
    Compound: 3-hydroxybutyryl-CoA dehydrogenase
    Species: Clostridium acetobutylicum [TaxId:272562]
    Gene: hbd, CA_C2708
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6acqd1, d6acqd2
  • Chain 'E':
    Compound: 3-hydroxybutyryl-CoA dehydrogenase
    Species: Clostridium acetobutylicum [TaxId:272562]
    Gene: hbd, CA_C2708
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6acqe1, d6acqe2
  • Chain 'F':
    Compound: 3-hydroxybutyryl-CoA dehydrogenase
    Species: Clostridium acetobutylicum [TaxId:272562]
    Gene: hbd, CA_C2708
    Database cross-references and differences (RAF-indexed):
    • Uniprot P52041 (20-End)
      • expression tag (11-19)
    Domains in SCOPe 2.07: d6acqf1, d6acqf2, d6acqf3
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6acqA (A:)
    mgsshhhhhhssglvprgshmkkvcvigagtmgsgiaqafaakgfevvlrdikdefvdrg
    ldfinknlsklvkkgkieeatkveiltrisgtvdlnmaadcdlvieaavermdikkqifa
    dldnickpetilasntsslsitevasatkrpdkvigmhffnpapvmklvevirgiatsqe
    tfdavketsiaigkdpvevaeapgfvvnrilipmineavgilaegiasvedidkamklga
    nhpmgplelgdfigldiclaimdvlysetgdskyrphtllkkyvragwlgrksgkgfydy
    sk
    

    Sequence, based on observed residues (ATOM records): (download)
    >6acqA (A:)
    mkkvcvigagtmgsgiaqafaakgfevvlrdikdefvdrgldfinknlsklvkkgkieea
    tkveiltrisgtvdlnmaadcdlvieaavermdikkqifadldnickpetilasntssls
    itevasatkrpdkvigmhffnpapvmklvevirgiatsqetfdavketsiaigkdpveva
    eapgfvvnrilipmineavgilaegiasvedidkamklganhpmgplelgdfigldicla
    imdvlysetgdskyrphtllkkyvragwlgrksgkgfydys
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >6acqB (B:)
    mgsshhhhhhssglvprgshmkkvcvigagtmgsgiaqafaakgfevvlrdikdefvdrg
    ldfinknlsklvkkgkieeatkveiltrisgtvdlnmaadcdlvieaavermdikkqifa
    dldnickpetilasntsslsitevasatkrpdkvigmhffnpapvmklvevirgiatsqe
    tfdavketsiaigkdpvevaeapgfvvnrilipmineavgilaegiasvedidkamklga
    nhpmgplelgdfigldiclaimdvlysetgdskyrphtllkkyvragwlgrksgkgfydy
    sk
    

    Sequence, based on observed residues (ATOM records): (download)
    >6acqB (B:)
    sglvprgshmkkvcvigagtmgsgiaqafaakgfevvlrdikdefvdrgldfinknlskl
    vkkgkieeatkveiltrisgtvdlnmaadcdlvieaavermdikkqifadldnickpeti
    lasntsslsitevasatkrpdkvigmhffnpapvmklvevirgiatsqetfdavketsia
    igkdpvevaeapgfvvnrilipmineavgilaegiasvedidkamklganhpmgplelgd
    figldiclaimdvlysetgdskyrphtllkkyvragwlgrksgkgfydy
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >6acqC (C:)
    mgsshhhhhhssglvprgshmkkvcvigagtmgsgiaqafaakgfevvlrdikdefvdrg
    ldfinknlsklvkkgkieeatkveiltrisgtvdlnmaadcdlvieaavermdikkqifa
    dldnickpetilasntsslsitevasatkrpdkvigmhffnpapvmklvevirgiatsqe
    tfdavketsiaigkdpvevaeapgfvvnrilipmineavgilaegiasvedidkamklga
    nhpmgplelgdfigldiclaimdvlysetgdskyrphtllkkyvragwlgrksgkgfydy
    sk
    

    Sequence, based on observed residues (ATOM records): (download)
    >6acqC (C:)
    mkkvcvigagtmgsgiaqafaakgfevvlrdikdefvdrgldfinknlsklvkkgkieea
    tkveiltrisgtvdlnmaadcdlvieaavermdikkqifadldnickpetilasntssls
    itevasatkrpdkvigmhffnpapvmklvevirgiatsqetfdavketsiaigkdpveva
    eapgfvvnrilipmineavgilaegiasvedidkamklganhpmgplelgdfigldicla
    imdvlysetgdskyrphtllkkyvragwlgrksgkgfydys
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >6acqD (D:)
    mgsshhhhhhssglvprgshmkkvcvigagtmgsgiaqafaakgfevvlrdikdefvdrg
    ldfinknlsklvkkgkieeatkveiltrisgtvdlnmaadcdlvieaavermdikkqifa
    dldnickpetilasntsslsitevasatkrpdkvigmhffnpapvmklvevirgiatsqe
    tfdavketsiaigkdpvevaeapgfvvnrilipmineavgilaegiasvedidkamklga
    nhpmgplelgdfigldiclaimdvlysetgdskyrphtllkkyvragwlgrksgkgfydy
    sk
    

    Sequence, based on observed residues (ATOM records): (download)
    >6acqD (D:)
    mkkvcvigagtmgsgiaqafaakgfevvlrdikdefvdrgldfinknlsklvkkgkieea
    tkveiltrisgtvdlnmaadcdlvieaavermdikkqifadldnickpetilasntssls
    itevasatkrpdkvigmhffnpapvmklvevirgiatsqetfdavketsiaigkdpveva
    eapgfvvnrilipmineavgilaegiasvedidkamklganhpmgplelgdfigldicla
    imdvlysetgdskyrphtllkkyvragwlgrksgkgfydys
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >6acqE (E:)
    mgsshhhhhhssglvprgshmkkvcvigagtmgsgiaqafaakgfevvlrdikdefvdrg
    ldfinknlsklvkkgkieeatkveiltrisgtvdlnmaadcdlvieaavermdikkqifa
    dldnickpetilasntsslsitevasatkrpdkvigmhffnpapvmklvevirgiatsqe
    tfdavketsiaigkdpvevaeapgfvvnrilipmineavgilaegiasvedidkamklga
    nhpmgplelgdfigldiclaimdvlysetgdskyrphtllkkyvragwlgrksgkgfydy
    sk
    

    Sequence, based on observed residues (ATOM records): (download)
    >6acqE (E:)
    mkkvcvigagtmgsgiaqafaakgfevvlrdikdefvdrgldfinknlsklvkkgkieea
    tkveiltrisgtvdlnmaadcdlvieaavermdikkqifadldnickpetilasntssls
    itevasatkrpdkvigmhffnpapvmklvevirgiatsqetfdavketsiaigkdpveva
    eapgfvvnrilipmineavgilaegiasvedidkamklganhpmgplelgdfigldicla
    imdvlysetgdskyrphtllkkyvragwlgrksgkgfydys
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >6acqF (F:)
    mgsshhhhhhssglvprgshmkkvcvigagtmgsgiaqafaakgfevvlrdikdefvdrg
    ldfinknlsklvkkgkieeatkveiltrisgtvdlnmaadcdlvieaavermdikkqifa
    dldnickpetilasntsslsitevasatkrpdkvigmhffnpapvmklvevirgiatsqe
    tfdavketsiaigkdpvevaeapgfvvnrilipmineavgilaegiasvedidkamklga
    nhpmgplelgdfigldiclaimdvlysetgdskyrphtllkkyvragwlgrksgkgfydy
    sk
    

    Sequence, based on observed residues (ATOM records): (download)
    >6acqF (F:)
    sglvprgshmkkvcvigagtmgsgiaqafaakgfevvlrdikdefvdrgldfinknlskl
    vkkgkieeatkveiltrisgtvdlnmaadcdlvieaavermdikkqifadldnickpeti
    lasntsslsitevasatkrpdkvigmhffnpapvmklvevirgiatsqetfdavketsia
    igkdpvevaeapgfvvnrilipmineavgilaegiasvedidkamklganhpmgplelgd
    figldiclaimdvlysetgdskyrphtllkkyvragwlgrksgkgfydys