PDB entry 6abp

View 6abp on RCSB PDB site
Description: sugar-binding and crystallographic studies of an arabinose-binding protein mutant (met108leu) which exhibits enhanced affinity and altered specificity
Deposited on 1991-04-25, released 1991-10-31
The last revision prior to the SCOP 1.55 freeze date was dated 1993-10-31, with a file datestamp of 1994-01-31.
Experiment type: -
Resolution: 1.67 Å
R-factor: 0.16
AEROSPACI score: 0.57 (click here for full SPACI score report)

Chains and heterogens:

  • Chain ' ':
    Domains in SCOP 1.55: d6abp__

PDB Chain Sequences:

  • Chain ' ':
    Sequence; same for both SEQRES and ATOM records: (download)
    >6abp_ (-)
    nlklgflvkqpeepwfqtewkfadkagkdlgfevikiavpdgektlnaidslaasgakgf
    victpdpklgsaivakargydmkviavddqfvnakgkpmdtvplvmlaatkigerqgqel
    ykemqkrgwdvkesavmaitaneldtarrrttgsmdalkaagfpekqiyqvptksndipg
    afdaansmlvqhpevkhwlivgmndstvlggvrategqgfkaadiigigingvdavsels
    kaqatgfygsllpspdvhgykssemlynwvakdveppkftevtdvvlitrdnfkeelekk
    glggk