PDB entry 6aaf

View 6aaf on RCSB PDB site
Description: Crystal structure of fission yeast Atg8 complexed with the helical AIM of Hfl1.
Class: membrane protein
Keywords: vacuole, autophagy, MEMBRANE PROTEIN
Deposited on 2018-07-18, released 2018-12-12
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-12-12, with a file datestamp of 2018-12-07.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: N/A
AEROSPACI score: 0.26 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Autophagy-related protein 8
    Species: Schizosaccharomyces pombe (strain 972 / ATCC 24843) [TaxId:284812]
    Gene: atg8, SPBP8B7.24c
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6aafa_
  • Chain 'B':
    Compound: Transmembrane protein 184 homolog C30D11.06c
    Species: Schizosaccharomyces pombe (strain 972 / ATCC 24843) [TaxId:284812]
    Gene: SPAC30D11.06c
    Database cross-references and differences (RAF-indexed):
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6aafA (A:)
    gphmrsqfkddfsfekrktesqrirekypdripvicekvdksdiaaidkkkylvpsdltv
    gqfvyvirkriklspekaififideilpptaalmstiyeehksedgflyitysgentfg
    

    Sequence, based on observed residues (ATOM records): (download)
    >6aafA (A:)
    rsqfkddfsfekrktesqrirekypdripvicekvdksdiaaidkkkylvpsdltvgqfv
    yvirkriklspekaififideilpptaalmstiyeehksedgflyitysgen
    

  • Chain 'B':
    No sequence available.