PDB entry 6a8p

View 6a8p on RCSB PDB site
Description: Transglutaminase 2 mutant G224V in complex with GTP
Class: transferase
Keywords: Transglutaminase, Complex, Mutant, GTP, TRANSFERASE
Deposited on 2018-07-09, released 2018-09-26
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-09-26, with a file datestamp of 2018-09-21.
Experiment type: XRAY
Resolution: 2.54 Å
R-factor: N/A
AEROSPACI score: 0.2 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Protein-glutamine gamma-glutamyltransferase 2
    Species: Homo sapiens [TaxId:9606]
    Gene: TGM2
    Database cross-references and differences (RAF-indexed):
    • Uniprot P21980 (0-686)
      • expression tag (687)
    Domains in SCOPe 2.07: d6a8pa1, d6a8pa2, d6a8pa3, d6a8pa4, d6a8pa5
  • Chain 'B':
    Compound: Protein-glutamine gamma-glutamyltransferase 2
    Species: Homo sapiens [TaxId:9606]
    Gene: TGM2
    Database cross-references and differences (RAF-indexed):
    • Uniprot P21980 (Start-686)
      • expression tag (687-691)
    Domains in SCOPe 2.07: d6a8pb1, d6a8pb2, d6a8pb3, d6a8pb4, d6a8pb5
  • Chain 'C':
    Compound: Protein-glutamine gamma-glutamyltransferase 2
    Species: Homo sapiens [TaxId:9606]
    Gene: TGM2
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6a8pc1, d6a8pc2, d6a8pc3, d6a8pc4
  • Heterogens: GTP

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6a8pA (A:)
    maeelvlercdleletngrdhhtadlcreklvvrrgqpfwltlhfegrnyeasvdsltfs
    vvtgpapsqeagtkarfplrdaveegdwtatvvdqqdctlslqlttpanapiglyrlsle
    astgyqgssfvlghfillfnawcpadavyldseeerqeyvltqqgfiyqgsakfiknipw
    nfgqfedgildiclilldvnpkflknagrdcsrrsspvyvgrvvsgmvncnddqgvllgr
    wdnnygdgvspmswigsvdilrrwknhgcqrvkygqcwvfaavactvlrclgiptrvvtn
    ynsahdqnsnllieyfrnefgeiqgdksemiwnfhcwveswmtrpdlqpgyegwqaldpt
    pqeksegtyccgpvpvraikegdlstkydapfvfaevnadvvdwiqqddgsvhksinrsl
    ivglkistksvgrderedithtykypegsseereaftranhlnklaekeetgmamrirvg
    qsmnmgsdfdvfahitnntaeeyvcrlllcartvsyngilgpecgtkyllnlnlepfsek
    svplcilyekyrdcltesnlikvrallvepvinsyllaerdlylenpeikirilgepkqk
    rklvaevslqnplpvalegctftvegaglteeqktveipdpveageevkvrmdllplhmg
    lhklvvnfesdklkavkgfrnviigpalehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >6a8pA (A:)
    maeelvlercdleletngrdhhtadlcreklvvrrgqpfwltlhfegrnyeasvdsltfs
    vvtgpapsqeagtkarfplrdaveegdwtatvvdqqdctlslqlttpanapiglyrlsle
    astgyqgssfvlghfillfnawcpadavyldseeerqeyvltqqgfiyqgsakfiknipw
    nfgqfedgildiclilldvnpkflknagrdcsrrsspvyvgrvvsgmvncnddqgvllgr
    wdnnygdgvspmswigsvdilrrwknhgcqrvkygqcwvfaavactvlrclgiptrvvtn
    ynsahdqnsnllieyfrnefgeiqgdksemiwnfhcwveswmtrpdlqpgyegwqaldpt
    pqeksegtyccgpvpvraikegdlstkydapfvfaevnadvvdwiqqddgsvhksinrsl
    ivglkistksvgrderedithtykypegsseereaftranhlntgmamrirvgqsmnmgs
    dfdvfahitnntaeeyvcrlllcartvsyngilgpecgtkyllnlnlepfseksvplcil
    yekyrdcltesnlikvrallvepvinsyllaerdlylenpeikirilgepkqkrklvaev
    slqnplpvalegctftvegaglteeqktveipdpveageevkvrmdllplhmglhklvvn
    fesdklkavkgfrnviigpal
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >6a8pB (B:)
    maeelvlercdleletngrdhhtadlcreklvvrrgqpfwltlhfegrnyeasvdsltfs
    vvtgpapsqeagtkarfplrdaveegdwtatvvdqqdctlslqlttpanapiglyrlsle
    astgyqgssfvlghfillfnawcpadavyldseeerqeyvltqqgfiyqgsakfiknipw
    nfgqfedgildiclilldvnpkflknagrdcsrrsspvyvgrvvsgmvncnddqgvllgr
    wdnnygdgvspmswigsvdilrrwknhgcqrvkygqcwvfaavactvlrclgiptrvvtn
    ynsahdqnsnllieyfrnefgeiqgdksemiwnfhcwveswmtrpdlqpgyegwqaldpt
    pqeksegtyccgpvpvraikegdlstkydapfvfaevnadvvdwiqqddgsvhksinrsl
    ivglkistksvgrderedithtykypegsseereaftranhlnklaekeetgmamrirvg
    qsmnmgsdfdvfahitnntaeeyvcrlllcartvsyngilgpecgtkyllnlnlepfsek
    svplcilyekyrdcltesnlikvrallvepvinsyllaerdlylenpeikirilgepkqk
    rklvaevslqnplpvalegctftvegaglteeqktveipdpveageevkvrmdllplhmg
    lhklvvnfesdklkavkgfrnviigpalehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >6a8pB (B:)
    ercdleletngrdhhtadlcreklvvrrgqpfwltlhfegrnyeasvdsltfsvvtgpap
    sqeagtkarfplrdaveegdwtatvvdqqdctlslqlttpanapiglyrlsleassfvlg
    hfillfnawcpadavyldseeerqeyvltqqgfiyqgsakfiknipwnfgqfedgildic
    lilldvnpkflknagrdcsrrsspvyvgrvvsgmvncnddqgvllgrwdnnygdgvspms
    wigsvdilrrwknhgcqrvkygqcwvfaavactvlrclgiptrvvtnynsahdqnsnlli
    eyfrnefgeiqgdksemiwnfhcwveswmtrpdlqpgyegwqaldptpqyccgpvpvrai
    kegdlstkydapfvfaevnadvvdwiqqddgsvhksinrslivglkistksvgrderedi
    thtykypegsseereaftranhlntgmamrirvgqsmnmgsdfdvfahitnntaeeyvcr
    lllcartvsyngilgpecgtkyllnlnlepfseksvplcilyekyrdcltesnlikvral
    lvepvinsyllaerdlylenpeikirilgepkqkrklvaevslqnplpvalegctftveg
    aglteeqktveipdpveageevkvrmdllplhmglhklvvnfesdklkavkgfrnviigp
    alehhh
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >6a8pC (C:)
    maeelvlercdleletngrdhhtadlcreklvvrrgqpfwltlhfegrnyeasvdsltfs
    vvtgpapsqeagtkarfplrdaveegdwtatvvdqqdctlslqlttpanapiglyrlsle
    astgyqgssfvlghfillfnawcpadavyldseeerqeyvltqqgfiyqgsakfiknipw
    nfgqfedgildiclilldvnpkflknagrdcsrrsspvyvgrvvsgmvncnddqgvllgr
    wdnnygdgvspmswigsvdilrrwknhgcqrvkygqcwvfaavactvlrclgiptrvvtn
    ynsahdqnsnllieyfrnefgeiqgdksemiwnfhcwveswmtrpdlqpgyegwqaldpt
    pqeksegtyccgpvpvraikegdlstkydapfvfaevnadvvdwiqqddgsvhksinrsl
    ivglkistksvgrderedithtykypegsseereaftranhlnklaekeetgmamrirvg
    qsmnmgsdfdvfahitnntaeeyvcrlllcartvsyngilgpecgtkyllnlnlepfsek
    svplcilyekyrdcltesnlikvrallvepvinsyllaerdlylenpeikirilgepkqk
    rklvaevslqnplpvalegctftvegaglteeqktveipdpveageevkvrmdllplhmg
    lhklvvnfesdklkavkgfrnviigpalehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >6a8pC (C:)
    maeelvlercdleletngrdhhtadlcreklvvrrgqpfwltlhfegrnyeasvdsltfs
    vvtgpapsqeagtkarfplrdaveegdwtatvvdqqdctlslqlttpanapiglyrlsle
    astgyqgssfvlghfillfnawcpadavyldseeerqeyvltqqgfiyqgsakfiknipw
    nfgqfedgildiclilldvnpkflknagrdcsrrsspvyvgrvvsgmvncnddqgvllgr
    wdnnygdgvspmswigsvdilrrwknhgcqrvkygqcwvfaavactvlrclgiptrvvtn
    ynsahdqnsnllieyfrnefgeiqgdksemiwnfhcwveswmtrpdlqpgyegwqaldpt
    pqeksegtyccgpvpvraikegdlstkydapfvfaevnadvvdwiqqddgsvhksinrsl
    ivglkistksvgrderedithtykypegsseereaftranhlntgmamrirvgqsmnmgs
    dfdvfahitnntaeeyvcrlllcartvsyngilgpecgtkyllnlnlepfseksvplcil
    yekyrdcltesnlikvrallvepvinsyllaerdlylenpeikirilgepkqkrklvaev
    slqnplpvalegctftvegaglteeqktveipdpveageevkvrmdllplhmglhklvvn
    fesdklkavkgfrnviigpa