PDB entry 6a8h

View 6a8h on RCSB PDB site
Description: Crystal structure of endo-arabinanase ABN-TS D27A mutant in complex with arabinotriose
Class: hydrolase
Keywords: arabinanase, thermostable enzyme, glycoside hydrolase, gh43, HYDROLASE
Deposited on 2018-07-09, released 2018-12-19
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-12-19, with a file datestamp of 2018-12-14.
Experiment type: XRAY
Resolution: 1.65 Å
R-factor: N/A
AEROSPACI score: 0.41 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Endo-alpha-(1->5)-L-arabinanase
    Species: Geobacillus thermodenitrificans [TaxId:33940]
    Gene: abn-ts
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q93HT9 (Start-312)
      • engineered mutation (26)
      • expression tag (313-315)
    Domains in SCOPe 2.07: d6a8ha1, d6a8ha2
  • Heterogens: CA, MG, AHR, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6a8hA (A:)
    mvhfhpfgnvnfyemdwslkgdlwahapviakegsrwyvfhtgsgiqiktsedgvhwenm
    grvfpslpdwckqyvpekdedhlwapdicfyngiyylyysvstfgkntsviglatnrtld
    prdpdyewkdmgpvihstasdnynaidpnvvfdqegqpwlsfgsfwsgiqliqldtetmk
    paaqaelltiasrgeepnaieapfivcrngyyylfvsfdfccrgiestykiavgrskdit
    gpyvdkngvsmmqgggtildagndrwigpghcavyfsgvsailvnhaydalkngeptlqi
    rplywddegwpyllehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >6a8hA (A:)
    vhfhpfgnvnfyemdwslkgdlwahapviakegsrwyvfhtgsgiqiktsedgvhwenmg
    rvfpslpdwckqyvpekdedhlwapdicfyngiyylyysvstfgkntsviglatnrtldp
    rdpdyewkdmgpvihstasdnynaidpnvvfdqegqpwlsfgsfwsgiqliqldtetmkp
    aaqaelltiasrgeepnaieapfivcrngyyylfvsfdfccrgiestykiavgrskditg
    pyvdkngvsmmqgggtildagndrwigpghcavyfsgvsailvnhaydalkngeptlqir
    plywddegwpylleh