PDB entry 6a7i

View 6a7i on RCSB PDB site
Description: CYP154C4 from Streptomyces sp. W2061
Class: oxidoreductase
Keywords: cytochrome P450, Streptomyces, steroid hydroxylase, OXIDOREDUCTASE
Deposited on 2018-07-03, released 2019-01-16
The last revision prior to the SCOPe 2.07 freeze date was dated 2019-01-16, with a file datestamp of 2019-01-11.
Experiment type: XRAY
Resolution: 2.19 Å
R-factor: N/A
AEROSPACI score: 0.26 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: cytochrome p450
    Species: Streptomyces sp. JS01 [TaxId:1525753]
    Gene: IX27_04735
    Database cross-references and differences (RAF-indexed):
    • Uniprot A0A087KD84 (2-End)
      • expression tag (0-1)
      • conflict (61)
      • conflict (193)
      • conflict (201)
      • conflict (204)
      • conflict (271)
      • conflict (303)
    Domains in SCOPe 2.07: d6a7ia1, d6a7ia2
  • Heterogens: HEM, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6a7iA (A:)
    rlmtrialdpfvrdldgesaalraagplaevelpggvhvyavtrhaearalltdsrvvkd
    idvwnawrrgeipmdwpliglanpgrsmltvdgadhrrlrtlvaqaltvkrverlragie
    altnasleklaalpagepvdlkaefayplpmnviselmgvdaadhprlkelfekffstqt
    ppeevpqmmadlgalftkivdakrtnpgddltsaliaasengdhltdeeivntlqliiaa
    ghettislivnvvealqthpeqrkkvlngeigwdgvieetlrwntptshvlirfatedie
    vgdkilpkgegliisfgalgrdeeqygptagefdatrtpnrhiafghgphvcpgaalsrl
    eagialpalyerfpeldlavpasdlrnkpivtqndlhelpvklgcpfggda
    

    Sequence, based on observed residues (ATOM records): (download)
    >6a7iA (A:)
    rlmtrialdpfvrdldgesaalraagplaevelpggvhvyavtrhaearalltdsrvvkd
    idvwnawrrgeipmdwpliglanpgrsmltvdgadhrrlrtlvaqaltvkrverlragie
    altnasleklaalpagepvdlkaefayplpmnviselmgvdaadhprlkelfekffstqt
    ppeevpqmmadlgalftkivdakrtnpgddltsaliaasengdhltdeeivntlqliiaa
    ghettislivnvvealqthpeqrkkvlngeigwdgvieetlrwntptshvlirfatedie
    vgdkilpkgegliisfgalgrdeeqygptagefdatrtpnrhiafghgphvcpgaalsrl
    eagialpalyerfpeldlavpasdlrnkpivtqndlhelpvklgcpfgg