PDB entry 6a78

View 6a78 on RCSB PDB site
Description: Crystal structure of the fifth immunoglobulin domain (Ig5) of human Robo1 in complex with the scFv fragment of murine monoclonal antibody B5209B
Class: immune system
Keywords: hepatocellular carcinoma antigen, angiogenesis, immune system, antibody drug, single chain Fv fragment
Deposited on 2018-07-02, released 2019-01-30
The last revision prior to the SCOPe 2.07 freeze date was dated 2019-01-30, with a file datestamp of 2019-01-25.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: N/A
AEROSPACI score: 0.28 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: roundabout homolog 1
    Species: Homo sapiens [TaxId:9606]
    Gene: ROBO1, DUTT1
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9Y6N7 (2-90)
      • expression tag (1)
    Domains in SCOPe 2.07: d6a78a1, d6a78a2
  • Chain 'B':
    Compound: roundabout homolog 1
    Species: Homo sapiens [TaxId:9606]
    Gene: ROBO1, DUTT1
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9Y6N7 (2-90)
      • expression tag (1)
    Domains in SCOPe 2.07: d6a78b1, d6a78b2
  • Chain 'H':
    Compound: Heavy chain and linker region of the anti-human Robo1 antibody B5209B scFv
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 6A78 (0-End)
    Domains in SCOPe 2.07: d6a78h_
  • Chain 'I':
    Compound: Heavy chain and linker region of the anti-human Robo1 antibody B5209B scFv
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 6A78 (0-End)
    Domains in SCOPe 2.07: d6a78i_
  • Chain 'L':
    Compound: Light chain region of the anti-human Robo1 antibody B5209B scFv
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 6A78
    Domains in SCOPe 2.07: d6a78l_
  • Chain 'M':
    Compound: Light chain region of the anti-human Robo1 antibody B5209B scFv
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 6A78
    Domains in SCOPe 2.07: d6a78m_
  • Heterogens: SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6a78A (A:)
    mgpvirqgpvnqtvavdgtfvlscvatgspvptilwrkdgvlvstqdsrikqlengvlqi
    ryaklgdtgrytciastpsgeatwsayievq
    

    Sequence, based on observed residues (ATOM records): (download)
    >6a78A (A:)
    gpvirqgpvnqtvavdgtfvlscvatgspvptilwrkdgvlvstqdsrikqlengvlqir
    yaklgdtgrytciastpsgeatwsayievq
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >6a78B (B:)
    mgpvirqgpvnqtvavdgtfvlscvatgspvptilwrkdgvlvstqdsrikqlengvlqi
    ryaklgdtgrytciastpsgeatwsayievq
    

    Sequence, based on observed residues (ATOM records): (download)
    >6a78B (B:)
    gpvirqgpvnqtvavdgtfvlscvatgspvptilwrkdgvlvstqdsrikqlengvlqir
    yaklgdtgrytciastpsgeatwsayievq
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >6a78H (H:)
    evqlvesgggvvqpggslklscaasgftfstydmswvrqtpdkrlelvatinsnggstyy
    pdsvkgrftssrdnaknilylqmsslksedtamyycareallrppyyaldywgqgtsvtv
    ssaggggsggggsggggs
    

    Sequence, based on observed residues (ATOM records): (download)
    >6a78H (H:)
    evqlvesgggvvqpggslklscaasgftfstydmswvrqtpdkrlelvatinsnggstyy
    pdsvkgrftssrdnaknilylqmsslksedtamyycareallrppyyaldywgqgtsvtv
    s
    

  • Chain 'I':
    Sequence, based on SEQRES records: (download)
    >6a78I (I:)
    evqlvesgggvvqpggslklscaasgftfstydmswvrqtpdkrlelvatinsnggstyy
    pdsvkgrftssrdnaknilylqmsslksedtamyycareallrppyyaldywgqgtsvtv
    ssaggggsggggsggggs
    

    Sequence, based on observed residues (ATOM records): (download)
    >6a78I (I:)
    evqlvesgggvvqpggslklscaasgftfstydmswvrqtpdkrlelvatinsnggstyy
    pdsvkgrftssrdnaknilylqmsslksedtamyycareallrppyyaldywgqgtsvtv
    ss
    

  • Chain 'L':
    Sequence, based on SEQRES records: (download)
    >6a78L (L:)
    dildiqmtqspaslsasvgetvtitcgaseniygaltwyqrkqgkspqlliygainladd
    kssrfsgsgsgrqyslkisslhpddvatyycqnvlstpftfgsgtkleikaa
    

    Sequence, based on observed residues (ATOM records): (download)
    >6a78L (L:)
    ldiqmtqspaslsasvgetvtitcgaseniygaltwyqrkqgkspqlliygainladdks
    srfsgsgsgrqyslkisslhpddvatyycqnvlstpftfgsgtkleik
    

  • Chain 'M':
    Sequence, based on SEQRES records: (download)
    >6a78M (M:)
    dildiqmtqspaslsasvgetvtitcgaseniygaltwyqrkqgkspqlliygainladd
    kssrfsgsgsgrqyslkisslhpddvatyycqnvlstpftfgsgtkleikaa
    

    Sequence, based on observed residues (ATOM records): (download)
    >6a78M (M:)
    ildiqmtqspaslsasvgetvtitcgaseniygaltwyqrkqgkspqlliygainladdk
    ssrfsgsgsgrqyslkisslhpddvatyycqnvlstpftfgsgtkleika