PDB entry 6a67

View 6a67 on RCSB PDB site
Description: Crystal structure of influenza A virus H5 hemagglutinin globular head in complex with the Fab of antibody FLD21.140
Class: immune system
Keywords: influenza virus, H5N1, neutralizing antibodies, receptor binding site, IMMUNE SYSTEM
Deposited on 2018-06-26, released 2018-08-29
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-09-19, with a file datestamp of 2018-09-14.
Experiment type: XRAY
Resolution: 2.33 Å
R-factor: N/A
AEROSPACI score: 0.23 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Hemagglutinin
    Species: Influenza A virus (A/Thailand/1(KAN-1)/2004(H5N1)) [TaxId:266827]
    Database cross-references and differences (RAF-indexed):
  • Chain 'B':
    Compound: Hemagglutinin
    Species: Influenza A virus (A/Thailand/1(KAN-1)/2004(H5N1)) [TaxId:266827]
    Database cross-references and differences (RAF-indexed):
  • Chain 'C':
    Compound: FLD21.140 Heavy Chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 6A67 (0-225)
  • Chain 'D':
    Compound: FLD21.140 Light Chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 6A67
    Domains in SCOPe 2.07: d6a67d1, d6a67d2
  • Chain 'H':
    Compound: FLD21.140 Heavy Chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 6A67 (0-225)
  • Chain 'L':
    Compound: FLD21.140 Light Chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 6A67
    Domains in SCOPe 2.07: d6a67l1, d6a67l2
  • Heterogens: NAG, HOH

PDB Chain Sequences:

  • Chain 'A':
    No sequence available.

  • Chain 'B':
    No sequence available.

  • Chain 'C':
    No sequence available.

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >6a67D (D:)
    qsvltqppsasgtpgqrvtiscsgstsnigsnavnwyqqlpgtapklliysnnqrpsgvp
    drfsgsksgtsaslaisglqsedeadyycaawddslsgswvfgggtkltvlgqpkanptv
    tlfppsseelqankatlvclisdfypgavtvawkadgspvkagvettkpskqsnnkyaas
    sylsltpeqwkshrsyscqvthegstvektvaptecs
    

    Sequence, based on observed residues (ATOM records): (download)
    >6a67D (D:)
    vltqppsasgtpgqrvtiscsgstsnigsnavnwyqqlpgtapklliysnnqrpsgvpdr
    fsgsksgtsaslaisglqsedeadyycaawddslsgswvfgggtkltvlgqpkanptvtl
    fppsseelqankatlvclisdfypgavtvawkadgspvkagvettkpskqsnnkyaassy
    lsltpeqwkshrsyscqvthegstvektvapt
    

  • Chain 'H':
    No sequence available.

  • Chain 'L':
    Sequence, based on SEQRES records: (download)
    >6a67L (L:)
    qsvltqppsasgtpgqrvtiscsgstsnigsnavnwyqqlpgtapklliysnnqrpsgvp
    drfsgsksgtsaslaisglqsedeadyycaawddslsgswvfgggtkltvlgqpkanptv
    tlfppsseelqankatlvclisdfypgavtvawkadgspvkagvettkpskqsnnkyaas
    sylsltpeqwkshrsyscqvthegstvektvaptecs
    

    Sequence, based on observed residues (ATOM records): (download)
    >6a67L (L:)
    vltqppsasgtpgqrvtiscsgstsnigsnavnwyqqlpgtapklliysnnqrpsgvpdr
    fsgsksgtsaslaisglqsedeadyycaawddslsgswvfgggtkltvlgqpkanptvtl
    fppsseelqankatlvclisdfypgavtvawkadgspvkagvettkpskqsnnkyaassy
    lsltpeqwkshrsyscqvthegstvektvapt