PDB entry 6a50

View 6a50 on RCSB PDB site
Description: structure of benzoylformate decarboxylases in complex with cofactor TPP
Class: lyase
Keywords: ThDP, Glycolaldehyde Synthase, LYASE
Deposited on 2018-06-21, released 2019-02-20
The last revision prior to the SCOPe 2.07 freeze date was dated 2019-02-20, with a file datestamp of 2019-02-15.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: N/A
AEROSPACI score: 0.37 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: benzoylformate decarboxylases
    Species: Pseudomonas putida [TaxId:303]
    Database cross-references and differences (RAF-indexed):
    • PDB 6A50
    Domains in SCOPe 2.07: d6a50a1, d6a50a2, d6a50a3, d6a50a4
  • Chain 'B':
    Compound: benzoylformate decarboxylases
    Species: Pseudomonas putida [TaxId:303]
    Database cross-references and differences (RAF-indexed):
    • PDB 6A50
    Domains in SCOPe 2.07: d6a50b1, d6a50b2, d6a50b3, d6a50b4
  • Heterogens: MG, TPP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6a50A (A:)
    mgsshhhhhhssglvprgshmmasvhgttyellrrqgidtvfgnpgsnelpflkdfpedf
    ryilalqeacvvgiadgyaqasrkpafinlhsaagtgnamgalsnartshsplivtagqq
    tramigveagetnvdaanlprplvkwsyepasaaevphamsraihmasmapqgpvylsvp
    yddwdkdadpqshhlfdrhvsssvrlndqdldilvkalnsasnpaivlgpdvdaananad
    cvmlaerlkapvwvapsaprcpfptrhpcfrglmpagiaaisqlleghdvvlvigapvfr
    yvfydpgqylkpgtrlisvtcdpleaarapmgdaivadigamasalanlveessrqlpta
    apepakvdqdagrlhpetvfdtlndmapenaiylneststtaqmwqrlnmrnpgsyyfca
    agglgfalpaaigvqlaeperqviavigdgsanysisalwtaaqyniptifvimnngtyg
    mlrwfagvleaenvpgldvpgidfralakgygvqalkadnleqlkgslqealsakgpvli
    evstvspvk
    

    Sequence, based on observed residues (ATOM records): (download)
    >6a50A (A:)
    masvhgttyellrrqgidtvfgnpgsnelpflkdfpedfryilalqeacvvgiadgyaqa
    srkpafinlhsaagtgnamgalsnartshsplivtagqqtramigveagetnvdaanlpr
    plvkwsyepasaaevphamsraihmasmapqgpvylsvpyddwdkdadpqshhlfdrhvs
    ssvrlndqdldilvkalnsasnpaivlgpdvdaananadcvmlaerlkapvwvapsaprc
    pfptrhpcfrglmpagiaaisqlleghdvvlvigapvfryvfydpgqylkpgtrlisvtc
    dpleaarapmgdaivadigamasalanlveessrqlptaapepakvdqdagrlhpetvfd
    tlndmapenaiylneststtaqmwqrlnmrnpgsyyfcaagglgfalpaaigvqlaeper
    qviavigdgsanysisalwtaaqyniptifvimnngtygmlrwfagvleaenvpgldvpg
    idfralakgygvqalkadnleqlkgslqealsakgpvlievstvspv
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >6a50B (B:)
    mgsshhhhhhssglvprgshmmasvhgttyellrrqgidtvfgnpgsnelpflkdfpedf
    ryilalqeacvvgiadgyaqasrkpafinlhsaagtgnamgalsnartshsplivtagqq
    tramigveagetnvdaanlprplvkwsyepasaaevphamsraihmasmapqgpvylsvp
    yddwdkdadpqshhlfdrhvsssvrlndqdldilvkalnsasnpaivlgpdvdaananad
    cvmlaerlkapvwvapsaprcpfptrhpcfrglmpagiaaisqlleghdvvlvigapvfr
    yvfydpgqylkpgtrlisvtcdpleaarapmgdaivadigamasalanlveessrqlpta
    apepakvdqdagrlhpetvfdtlndmapenaiylneststtaqmwqrlnmrnpgsyyfca
    agglgfalpaaigvqlaeperqviavigdgsanysisalwtaaqyniptifvimnngtyg
    mlrwfagvleaenvpgldvpgidfralakgygvqalkadnleqlkgslqealsakgpvli
    evstvspvk
    

    Sequence, based on observed residues (ATOM records): (download)
    >6a50B (B:)
    masvhgttyellrrqgidtvfgnpgsnelpflkdfpedfryilalqeacvvgiadgyaqa
    srkpafinlhsaagtgnamgalsnartshsplivtagqqtramigveagetnvdaanlpr
    plvkwsyepasaaevphamsraihmasmapqgpvylsvpyddwdkdadpqshhlfdrhvs
    ssvrlndqdldilvkalnsasnpaivlgpdvdaananadcvmlaerlkapvwvapsaprc
    pfptrhpcfrglmpagiaaisqlleghdvvlvigapvfryvfydpgqylkpgtrlisvtc
    dpleaarapmgdaivadigamasalanlveessrqlptaapepakvdqdagrlhpetvfd
    tlndmapenaiylneststtaqmwqrlnmrnpgsyyfcaagglgfalpaaigvqlaeper
    qviavigdgsanysisalwtaaqyniptifvimnngtygmlrwfagvleaenvpgldvpg
    idfralakgygvqalkadnleqlkgslqealsakgpvlievstvspv