PDB entry 6a3w

View 6a3w on RCSB PDB site
Description: Complex structure of 4-1BB and utomilumab
Class: immune system
Keywords: complex structure, 4-1BB, angonist monoclonal antibody, IMMUNE SYSTEM
Deposited on 2018-06-17, released 2018-10-10
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-10-10, with a file datestamp of 2018-10-05.
Experiment type: XRAY
Resolution: 2 Å
R-factor: N/A
AEROSPACI score: 0.31 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: utomilumab VH
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 6A3W (0-115)
    Domains in SCOPe 2.07: d6a3wa_
  • Chain 'B':
    Compound: utomilumab VL
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 6A3W (Start-108)
    Domains in SCOPe 2.07: d6a3wb_
  • Chain 'C':
    Compound: Tumor necrosis factor receptor superfamily member 9
    Species: Homo sapiens [TaxId:9606]
    Gene: TNFRSF9, CD137, ILA
    Database cross-references and differences (RAF-indexed):
  • Chain 'D':
    Compound: utomilumab VH
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 6A3W (0-115)
    Domains in SCOPe 2.07: d6a3wd_
  • Chain 'E':
    Compound: utomilumab VL
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 6A3W (Start-108)
    Domains in SCOPe 2.07: d6a3we_
  • Chain 'F':
    Compound: Tumor necrosis factor receptor superfamily member 9
    Species: Homo sapiens [TaxId:9606]
    Gene: TNFRSF9, CD137, ILA
    Database cross-references and differences (RAF-indexed):
  • Chain 'G':
    Compound: utomilumab VH
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 6A3W (0-115)
    Domains in SCOPe 2.07: d6a3wg_
  • Chain 'H':
    Compound: utomilumab VL
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 6A3W (Start-108)
    Domains in SCOPe 2.07: d6a3wh_
  • Chain 'I':
    Compound: Tumor necrosis factor receptor superfamily member 9
    Species: Homo sapiens [TaxId:9606]
    Gene: TNFRSF9, CD137, ILA
    Database cross-references and differences (RAF-indexed):
  • Chain 'J':
    Compound: utomilumab VH
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 6A3W (0-115)
    Domains in SCOPe 2.07: d6a3wj_
  • Chain 'K':
    Compound: utomilumab VL
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 6A3W (Start-108)
    Domains in SCOPe 2.07: d6a3wk_
  • Chain 'L':
    Compound: Tumor necrosis factor receptor superfamily member 9
    Species: Homo sapiens [TaxId:9606]
    Gene: TNFRSF9, CD137, ILA
    Database cross-references and differences (RAF-indexed):
  • Heterogens: NAG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >6a3wA (A:)
    evqlvqsgaevkkpgeslrisckgsgysfstywiswvrqmpgkglewmgkiypgdsytny
    spsfqgqvtisadksistaylqwsslkasdtamyycargygifdywgqgtlvtvss
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >6a3wB (B:)
    msyeltqppsvsvspgqtasitcsgdnigdqyahwyqqkpgqspvlviyqdknrpsgipe
    rfsgsnsgntatltisgtqamdeadyycatytgfgslavfgggtkltvl
    

    Sequence, based on observed residues (ATOM records): (download)
    >6a3wB (B:)
    eltqppsvsvspgqtasitcsgdnigdqyahwyqqkpgqspvlviyqdknrpsgiperfs
    gsnsgntatltisgtqamdeadyycatytgfgslavfgggtkltvl
    

  • Chain 'C':
    No sequence available.

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >6a3wD (D:)
    evqlvqsgaevkkpgeslrisckgsgysfstywiswvrqmpgkglewmgkiypgdsytny
    spsfqgqvtisadksistaylqwsslkasdtamyycargygifdywgqgtlvtvss
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >6a3wE (E:)
    msyeltqppsvsvspgqtasitcsgdnigdqyahwyqqkpgqspvlviyqdknrpsgipe
    rfsgsnsgntatltisgtqamdeadyycatytgfgslavfgggtkltvl
    

    Sequence, based on observed residues (ATOM records): (download)
    >6a3wE (E:)
    yeltqppsvsvspgqtasitcsgdnigdqyahwyqqkpgqspvlviyqdknrpsgiperf
    sgsnsgntatltisgtqamdeadyycatytgfgslavfgggtkltvl
    

  • Chain 'F':
    No sequence available.

  • Chain 'G':
    Sequence; same for both SEQRES and ATOM records: (download)
    >6a3wG (G:)
    evqlvqsgaevkkpgeslrisckgsgysfstywiswvrqmpgkglewmgkiypgdsytny
    spsfqgqvtisadksistaylqwsslkasdtamyycargygifdywgqgtlvtvss
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >6a3wH (H:)
    msyeltqppsvsvspgqtasitcsgdnigdqyahwyqqkpgqspvlviyqdknrpsgipe
    rfsgsnsgntatltisgtqamdeadyycatytgfgslavfgggtkltvl
    

    Sequence, based on observed residues (ATOM records): (download)
    >6a3wH (H:)
    yeltqppsvsvspgqtasitcsgdnigdqyahwyqqkpgqspvlviyqdknrpsgiperf
    sgsnsgntatltisgtqamdeadyycatytgfgslavfgggtkltvl
    

  • Chain 'I':
    No sequence available.

  • Chain 'J':
    Sequence; same for both SEQRES and ATOM records: (download)
    >6a3wJ (J:)
    evqlvqsgaevkkpgeslrisckgsgysfstywiswvrqmpgkglewmgkiypgdsytny
    spsfqgqvtisadksistaylqwsslkasdtamyycargygifdywgqgtlvtvss
    

  • Chain 'K':
    Sequence, based on SEQRES records: (download)
    >6a3wK (K:)
    msyeltqppsvsvspgqtasitcsgdnigdqyahwyqqkpgqspvlviyqdknrpsgipe
    rfsgsnsgntatltisgtqamdeadyycatytgfgslavfgggtkltvl
    

    Sequence, based on observed residues (ATOM records): (download)
    >6a3wK (K:)
    yeltqppsvsvspgqtasitcsgdnigdqyahwyqqkpgqspvlviyqdknrpsgiperf
    sgsnsgntatltisgtqamdeadyycatytgfgslavfgggtkltvl
    

  • Chain 'L':
    No sequence available.