PDB entry 6a34

View 6a34 on RCSB PDB site
Description: Crystal structure of 5-methylthioribose 1-phosphate isomerase from Pyrococcus horikoshii OT3 - Form I
Class: isomerase
Keywords: Methionine salvage pathway, PH0702, Cis-phosphoenolate intermediate, Hydride transfer, ISOMERASE
Deposited on 2018-06-14, released 2018-12-12
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-12-12, with a file datestamp of 2018-12-07.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: N/A
AEROSPACI score: 0.24 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Putative methylthioribose-1-phosphate isomerase
    Species: Pyrococcus horikoshii OT3 [TaxId:70601]
    Gene: PH0702
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6a34a_
  • Chain 'B':
    Compound: Putative methylthioribose-1-phosphate isomerase
    Species: Pyrococcus horikoshii OT3 [TaxId:70601]
    Gene: PH0702
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6a34b_
  • Heterogens: HEZ, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6a34A (A:)
    meirytpkeltklprtveyknksvyminqrllpkefkvekfskveevaeaiknmtvrgap
    aigaaagfglalyaetskaktkeefldgfekayeilkntrptavnlfwalnrikklveeh
    sedpldeikrlivqeaykiadedveanlrmghygaevlpegnilthcnagslatvhlgtv
    gsvvrvmhkdgslkllwldetrpvlqgarlsaweysydglnvkliadnaaafvmqqgfvd
    aiivgadrivangdfankigtymlavlarehgipffavaplssidmelksgkdipieers
    peevltcggcriapdvpvynpafdvtphkyltgiitdrgvvwppfkrnlkklfevnksgg
    deav
    

    Sequence, based on observed residues (ATOM records): (download)
    >6a34A (A:)
    meirytpkeltklprtveyknksvyminqrllpkefkvekfskveevaeaiknmtvrgap
    aigaaagfglalyaetskaktkeefldgfekayeilkntrptavnlfwalnrikklveeh
    sedpldeikrlivqeaykiadedveanlrmghygaevlpegnilthcnagslatvhlgtv
    gsvvrvmhkdgslkllwldetrpvlqgarlsaweysydglnvkliadnaaafvmqqgfvd
    aiivgadrivangdfankigtymlavlarehgipffavaplssidmelksgkdipieers
    peevltcggcriapdvpvynpafdvtphkyltgiitdrgvvwppfkrnlkklfevn
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >6a34B (B:)
    meirytpkeltklprtveyknksvyminqrllpkefkvekfskveevaeaiknmtvrgap
    aigaaagfglalyaetskaktkeefldgfekayeilkntrptavnlfwalnrikklveeh
    sedpldeikrlivqeaykiadedveanlrmghygaevlpegnilthcnagslatvhlgtv
    gsvvrvmhkdgslkllwldetrpvlqgarlsaweysydglnvkliadnaaafvmqqgfvd
    aiivgadrivangdfankigtymlavlarehgipffavaplssidmelksgkdipieers
    peevltcggcriapdvpvynpafdvtphkyltgiitdrgvvwppfkrnlkklfevnksgg
    deav
    

    Sequence, based on observed residues (ATOM records): (download)
    >6a34B (B:)
    meirytpkeltklprtveyknksvyminqrllpkefkvekfskveevaeaiknmtvrgap
    aigaaagfglalyaetskaktkeefldgfekayeilkntrptavnlfwalnrikklveeh
    sedpldeikrlivqeaykiadedveanlrmghygaevlpegnilthcnagslatvhlgtv
    gsvvrvmhkdgslkllwldetrpvlqgarlsaweysydglnvkliadnaaafvmqqgfvd
    aiivgadrivangdfankigtymlavlarehgipffavaplssidmelksgkdipieers
    peevltcggcriapdvpvynpafdvtphkyltgiitdrgvvwppfkrnlkklfevn