PDB entry 6a31

View 6a31 on RCSB PDB site
Description: Crystal structure of Na+ bound Peptidyl-tRNA Hydrolase from Acinetobacter baumannii at 2.19 A resolution
Class: hydrolase
Keywords: hydrolase
Deposited on 2018-06-14, released 2018-06-27
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-06-27, with a file datestamp of 2018-06-22.
Experiment type: XRAY
Resolution: 2.19 Å
R-factor: N/A
AEROSPACI score: 0.27 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Peptidyl-tRNA hydrolase
  Species: Acinetobacter baumannii (strain ATCC 19606 / DSM 30007 / CIP 70.34 / JCM 6841 / NBRC 109757 / NCIMB 12457 / NCTC 12156 / 81) [TaxId:575584]
  Gene: pth, BIT33_16330, HMPREF0010_01329
  Database cross-references and differences (RAF-indexed):
  • Uniprot D0C9L6 (0-192)
  Domains in SCOPe 2.07: d6a31a_
• Heterogens: NA, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >6a31A (A:)
  msnislivglgnpgseyaqtrhnagfwfveqladkygitlkndpkfhgisgrgnieghdv
  rlllpmtymnrsgqsvvpfskfyqiapeailiahdeldmnpgvirlktggghgghnglrd
  ivphigpnfhrlrigighpgskervsghvlgkapsneqslmdgaidhalskvkllvqgqv
  pqamnqinaykpa