PDB entry 6a22

View 6a22 on RCSB PDB site
Description: Ternary complex of Human ROR gamma Ligand Binding Domain With Compound T.
Class: nuclear protein/inhibitor
Keywords: Ternary Complex, Nuclear Receptor, NUCLEAR PROTEIN, NUCLEAR PROTEIN-INHIBITOR complex
Deposited on 2018-06-08, released 2018-12-12
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-12-12, with a file datestamp of 2018-12-07.
Experiment type: XRAY
Resolution: 2.55 Å
R-factor: N/A
AEROSPACI score: 0.21 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Nuclear receptor ROR-gamma
    Species: Homo sapiens [TaxId:9606]
    Gene: RORC, NR1F3, RORG, RZRG
    Database cross-references and differences (RAF-indexed):
    • Uniprot P51449
      • engineered mutation (208)
      • engineered mutation (212)
    Domains in SCOPe 2.07: d6a22a_
  • Chain 'B':
    Compound: Nuclear receptor corepressor 2
    Species: Homo sapiens [TaxId:9606]
    Gene: NCOR2, CTG26
    Database cross-references and differences (RAF-indexed):
  • Chain 'C':
    Compound: Nuclear receptor ROR-gamma
    Species: Homo sapiens [TaxId:9606]
    Gene: RORC, NR1F3, RORG, RZRG
    Database cross-references and differences (RAF-indexed):
    • Uniprot P51449
      • engineered mutation (208)
      • engineered mutation (212)
    Domains in SCOPe 2.07: d6a22c_
  • Chain 'D':
    Compound: Nuclear receptor corepressor 2
    Species: Homo sapiens [TaxId:9606]
    Gene: NCOR2, CTG26
    Database cross-references and differences (RAF-indexed):
  • Chain 'E':
    Compound: Nuclear receptor ROR-gamma
    Species: Homo sapiens [TaxId:9606]
    Gene: RORC, NR1F3, RORG, RZRG
    Database cross-references and differences (RAF-indexed):
    • Uniprot P51449
      • engineered mutation (208)
      • engineered mutation (212)
    Domains in SCOPe 2.07: d6a22e_
  • Chain 'F':
    Compound: Nuclear receptor corepressor 2
    Species: Homo sapiens [TaxId:9606]
    Gene: NCOR2, CTG26
    Database cross-references and differences (RAF-indexed):
  • Chain 'G':
    Compound: Nuclear receptor ROR-gamma
    Species: Homo sapiens [TaxId:9606]
    Gene: RORC, NR1F3, RORG, RZRG
    Database cross-references and differences (RAF-indexed):
    • Uniprot P51449
      • engineered mutation (208)
      • engineered mutation (212)
    Domains in SCOPe 2.07: d6a22g_
  • Chain 'H':
    Compound: Nuclear receptor corepressor 2
    Species: Homo sapiens [TaxId:9606]
    Gene: NCOR2, CTG26
    Database cross-references and differences (RAF-indexed):
  • Heterogens: 9P6, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6a22A (A:)
    eapyaslteiehlvqsvcksyretcqlrledllrqrsnifsreevtgyqrksmwemwerc
    ahhlteaiqyvvefakrlsgfmelcqndqivllkagamevvlvrmcraynadnrtvffeg
    kyggmelfralgcselissifdfshslsalhfsedeialytalvlinahrpglqekrkve
    qlqynlelafhhhlckthrqsilaklppagklaslcsqhverlqifqhlhpivvqaafpp
    lykelfstetespvglsk
    

    Sequence, based on observed residues (ATOM records): (download)
    >6a22A (A:)
    pyaslteiehlvqsvcksyretcqlrledllrqrsnifsreevtgyqrksmwemwercah
    hlteaiqyvvefakrlsgfmelcqndqivllkagamevvlvrmcraynadnrtvffegky
    ggmelfralgcselissifdfshslsalhfsedeialytalvlinahrpglqekrkveql
    qynlelafhhhlckthrqsilaklppagklaslcsqhverlqifqhlhpiv
    

  • Chain 'B':
    No sequence available.

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >6a22C (C:)
    eapyaslteiehlvqsvcksyretcqlrledllrqrsnifsreevtgyqrksmwemwerc
    ahhlteaiqyvvefakrlsgfmelcqndqivllkagamevvlvrmcraynadnrtvffeg
    kyggmelfralgcselissifdfshslsalhfsedeialytalvlinahrpglqekrkve
    qlqynlelafhhhlckthrqsilaklppagklaslcsqhverlqifqhlhpivvqaafpp
    lykelfstetespvglsk
    

    Sequence, based on observed residues (ATOM records): (download)
    >6a22C (C:)
    slteiehlvqsvcksyretcqlrledllrqrsnifsreevtgyqrksmwemwercahhlt
    eaiqyvvefakrlsgfmelcqndqivllkagamevvlvrmcraynadnrtvffegkyggm
    elfralgcselissifdfshslsalhfsedeialytalvlinahrpglqekrkveqlqyn
    lelafhhhlckthrqsilaklppagklaslcsqhverlqifqhlhpiv
    

  • Chain 'D':
    No sequence available.

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >6a22E (E:)
    eapyaslteiehlvqsvcksyretcqlrledllrqrsnifsreevtgyqrksmwemwerc
    ahhlteaiqyvvefakrlsgfmelcqndqivllkagamevvlvrmcraynadnrtvffeg
    kyggmelfralgcselissifdfshslsalhfsedeialytalvlinahrpglqekrkve
    qlqynlelafhhhlckthrqsilaklppagklaslcsqhverlqifqhlhpivvqaafpp
    lykelfstetespvglsk
    

    Sequence, based on observed residues (ATOM records): (download)
    >6a22E (E:)
    slteiehlvqsvcksyretcqlrledllrqrsnifsreevtgyqrksmwemwercahhlt
    eaiqyvvefakrlsgfmelcqndqivllkagamevvlvrmcraynadnrtvffegkyggm
    elfralgcselissifdfshslsalhfsedeialytalvlinahrpglqekrkveqlqyn
    lelafhhhlckthrqsilaklppagklaslcsqhverlqifqhlhpiv
    

  • Chain 'F':
    No sequence available.

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >6a22G (G:)
    eapyaslteiehlvqsvcksyretcqlrledllrqrsnifsreevtgyqrksmwemwerc
    ahhlteaiqyvvefakrlsgfmelcqndqivllkagamevvlvrmcraynadnrtvffeg
    kyggmelfralgcselissifdfshslsalhfsedeialytalvlinahrpglqekrkve
    qlqynlelafhhhlckthrqsilaklppagklaslcsqhverlqifqhlhpivvqaafpp
    lykelfstetespvglsk
    

    Sequence, based on observed residues (ATOM records): (download)
    >6a22G (G:)
    slteiehlvqsvcksyretcqlrledllrqrsnifsreevtgyqrksmwemwercahhlt
    eaiqyvvefakrlsgfmelcqndqivllkagamevvlvrmcraynadnrtvffegkyggm
    elfralgcselissifdfshslsalhfsedeialytalvlinahrpglqekrkveqlqyn
    lelafhhhlckthrqsilaklppagklaslcsqhverlqifqhlhpiv
    

  • Chain 'H':
    No sequence available.