PDB entry 5zz9

View 5zz9 on RCSB PDB site
Description: Crystal structure of Homer2 EVH1/Drebrin PPXXF complex
Class: protein binding
Keywords: polyproline recognition, signaling protein, protein binding
Deposited on 2018-05-31, released 2018-12-19
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-12-19, with a file datestamp of 2018-12-14.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: N/A
AEROSPACI score: 0.25 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Homer protein homolog 2
    Species: Mus musculus [TaxId:10090]
    Gene: Homer2, Vesl2
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5zz9a_
  • Chain 'B':
    Compound: Homer protein homolog 2
    Species: Mus musculus [TaxId:10090]
    Gene: Homer2, Vesl2
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5zz9b_
  • Chain 'C':
    Compound: Homer protein homolog 2
    Species: Mus musculus [TaxId:10090]
    Gene: Homer2, Vesl2
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5zz9c_
  • Chain 'D':
    Compound: Peptide from Drebrin
    Species: Homo sapiens [TaxId:9606]
    Gene: DBN1, D0S117E
    Database cross-references and differences (RAF-indexed):
  • Chain 'E':
    Compound: Peptide from Drebrin
    Species: Homo sapiens [TaxId:9606]
    Gene: DBN1, D0S117E
    Database cross-references and differences (RAF-indexed):
  • Chain 'F':
    Compound: Peptide from Drebrin
    Species: Homo sapiens [TaxId:9606]
    Gene: DBN1, D0S117E
    Database cross-references and differences (RAF-indexed):
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5zz9A (A:)
    ggsggsggmgeqpifttrahvfqidpstkknwvpaskqavtvsyfydvtrnsyriisvdg
    akviinstitpnmtftktsqkfgqwadsrantvfglgfsselqltkfaekfqevreaarl
    ard
    

    Sequence, based on observed residues (ATOM records): (download)
    >5zz9A (A:)
    geqpifttrahvfqidpstkknwvpaskqavtvsyfydvtrnsyriisvdgakviinsti
    tpnmtftktsqkfgqwadsrantvfglgfsselqltkfaekfqevreaarlard
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5zz9B (B:)
    ggsggsggmgeqpifttrahvfqidpstkknwvpaskqavtvsyfydvtrnsyriisvdg
    akviinstitpnmtftktsqkfgqwadsrantvfglgfsselqltkfaekfqevreaarl
    ard
    

    Sequence, based on observed residues (ATOM records): (download)
    >5zz9B (B:)
    geqpifttrahvfqidpstkknwvpaskqavtvsyfydvtrnsyriisvdgakviinsti
    tpnmtftktsqkfgqwadsrantvfglgfsselqltkfaekfqevreaarlard
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >5zz9C (C:)
    ggsggsggmgeqpifttrahvfqidpstkknwvpaskqavtvsyfydvtrnsyriisvdg
    akviinstitpnmtftktsqkfgqwadsrantvfglgfsselqltkfaekfqevreaarl
    ard
    

    Sequence, based on observed residues (ATOM records): (download)
    >5zz9C (C:)
    eqpifttrahvfqidpstkknwvpaskqavtvsyfydvtrnsyriisvdgakviinstit
    pnmtftktsqkfgqwadsrantvfglgfsselqltkfaekfqevreaarlard
    

  • Chain 'D':
    No sequence available.

  • Chain 'E':
    No sequence available.

  • Chain 'F':
    No sequence available.