PDB entry 5zz6

View 5zz6 on RCSB PDB site
Description: Redox-sensing transcriptional repressor Rex
Class: gene regulation
Keywords: Redox sensing, transcription factor, GENE REGULATION
Deposited on 2018-05-30, released 2018-11-07
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-11-07, with a file datestamp of 2018-11-02.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: N/A
AEROSPACI score: 0.27 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Redox-sensing transcriptional repressor Rex 1
    Species: Thermotoga maritima MSB8 [TaxId:243274]
    Gene: rex1, TM_0169
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5zz6a1, d5zz6a2
  • Chain 'B':
    Compound: Redox-sensing transcriptional repressor Rex 1
    Species: Thermotoga maritima MSB8 [TaxId:243274]
    Gene: rex1, TM_0169
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5zz6b1, d5zz6b2
  • Chain 'C':
    Compound: Redox-sensing transcriptional repressor Rex 1
    Species: Thermotoga maritima MSB8 [TaxId:243274]
    Gene: rex1, TM_0169
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5zz6c1, d5zz6c2
  • Chain 'D':
    Compound: Redox-sensing transcriptional repressor Rex 1
    Species: Thermotoga maritima MSB8 [TaxId:243274]
    Gene: rex1, TM_0169
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5zz6d1, d5zz6d2
  • Heterogens: NAD, ADP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5zz6A (A:)
    maekipkpvskrlvsyymclerlldegvevvsseelarrldlkasqirkdlsyfgefgkr
    gvgynvehlydaigeilgvkkewklvvvgagnigravanytvmkekgfriigifdsdpsk
    igkeaapgltvsdvselekfveehgveigviavpaehaqeiaerlekagikgilnfapvk
    ikvsvpveniditaslrvltfeivrrns
    

    Sequence, based on observed residues (ATOM records): (download)
    >5zz6A (A:)
    vskrlvsyymclerlldegvevvsseelarrldlkasqirkdlsyfgefgkrgvgynveh
    lydaigeilgvkkewklvvvgagnigravanytvmkekgfriigifdsdpskigkeaapg
    ltvsdvselekfveehgveigviavpaehaqeiaerlekagikgilnfapvkikvsvpve
    niditaslrvltfeivrrns
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5zz6B (B:)
    maekipkpvskrlvsyymclerlldegvevvsseelarrldlkasqirkdlsyfgefgkr
    gvgynvehlydaigeilgvkkewklvvvgagnigravanytvmkekgfriigifdsdpsk
    igkeaapgltvsdvselekfveehgveigviavpaehaqeiaerlekagikgilnfapvk
    ikvsvpveniditaslrvltfeivrrns
    

    Sequence, based on observed residues (ATOM records): (download)
    >5zz6B (B:)
    kipkpvskrlvsyymclerlldegvevvsseelarrldlkasqirkdlsyfgefgkrgvg
    ynvehlydaigeilgvkkewklvvvgagnigravanytvmkekgfriigifdsdpskigk
    eaapgltvsdvselekfveehgveigviavpaehaqeiaerlekagikgilnfapvkikv
    svpveniditaslrvltfeivrrn
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >5zz6C (C:)
    maekipkpvskrlvsyymclerlldegvevvsseelarrldlkasqirkdlsyfgefgkr
    gvgynvehlydaigeilgvkkewklvvvgagnigravanytvmkekgfriigifdsdpsk
    igkeaapgltvsdvselekfveehgveigviavpaehaqeiaerlekagikgilnfapvk
    ikvsvpveniditaslrvltfeivrrns
    

    Sequence, based on observed residues (ATOM records): (download)
    >5zz6C (C:)
    kipkpvskrlvsyymclerlldegvevvsseelarrldlkasqirkdlsyfgefgkgynv
    ehlydaigeilgvkkewklvvvgagnigravanytvmkekgfriigifdsdpskigkeaa
    pgltvsdvselekfveehgveigviavpaehaqeiaerlekagikgilnfapvkikvsvp
    veniditaslrvltfeivrrn
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >5zz6D (D:)
    maekipkpvskrlvsyymclerlldegvevvsseelarrldlkasqirkdlsyfgefgkr
    gvgynvehlydaigeilgvkkewklvvvgagnigravanytvmkekgfriigifdsdpsk
    igkeaapgltvsdvselekfveehgveigviavpaehaqeiaerlekagikgilnfapvk
    ikvsvpveniditaslrvltfeivrrns
    

    Sequence, based on observed residues (ATOM records): (download)
    >5zz6D (D:)
    vskrlvsyymclerlldegvevseelarasqirkdlsyfgefgkrnvehlydaigeilgv
    kkewklvvvgagnigravanytvmkekgfriigifdsdpskigkeaapgltvsdvselek
    fveehgveigviavpaehaqeiaerlekagikgilnfapvkikvsvpveniditaslrvl
    tfeivrrn