PDB entry 5zz5

View 5zz5 on RCSB PDB site
Description: Redox-sensing transcriptional repressor Rex
Class: gene regulation
Keywords: Redox sensing, transcription factor, GENE REGULATION
Deposited on 2018-05-30, released 2018-11-07
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-11-07, with a file datestamp of 2018-11-02.
Experiment type: XRAY
Resolution: 2 Å
R-factor: N/A
AEROSPACI score: 0.31 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Redox-sensing transcriptional repressor rex
    Species: THERMOTOGA MARITIMA MSB8 [TaxId:243274]
    Gene: rex1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5zz5a1, d5zz5a2
  • Chain 'B':
    Compound: Redox-sensing transcriptional repressor rex
    Species: THERMOTOGA MARITIMA MSB8 [TaxId:243274]
    Gene: rex1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5zz5b1, d5zz5b2
  • Chain 'C':
    Compound: Redox-sensing transcriptional repressor rex
    Species: THERMOTOGA MARITIMA MSB8 [TaxId:243274]
    Gene: rex1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5zz5c1
  • Chain 'D':
    Compound: Redox-sensing transcriptional repressor rex
    Species: THERMOTOGA MARITIMA MSB8 [TaxId:243274]
    Gene: rex1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5zz5d1
  • Heterogens: GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5zz5A (A:)
    maekipkpvskrlvsyymclerlldegvevvsseelarrldlkasqirkdlsyfgefgkr
    gvgynvehlydaigeilgvkkewklvvvgagnigravanytvmkekgfriigifdsdpsk
    igkeaapgltvsdvselekfveehgveigviavpaehaqeiaerlekagikgilnfapvk
    ikvsvpveniditaslrvltfeivrrns
    

    Sequence, based on observed residues (ATOM records): (download)
    >5zz5A (A:)
    vskrlvsyymclerlldegvevvsseelarrldlkasqirkdlsyfgefgkrgvgynveh
    lydaigeilgvkkewklvvvgagnigravanytvmkekgfriigifdsdpskigkeaapg
    ltvsdvselekfveehgveigviavpaehaqeiaerlekagikgilnfapvkikvsvpve
    niditaslrvltfeivrrns
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5zz5B (B:)
    maekipkpvskrlvsyymclerlldegvevvsseelarrldlkasqirkdlsyfgefgkr
    gvgynvehlydaigeilgvkkewklvvvgagnigravanytvmkekgfriigifdsdpsk
    igkeaapgltvsdvselekfveehgveigviavpaehaqeiaerlekagikgilnfapvk
    ikvsvpveniditaslrvltfeivrrns
    

    Sequence, based on observed residues (ATOM records): (download)
    >5zz5B (B:)
    ekipkpvskrlvsyymclerlldegvevvsseelarrldlkasqirkdlsyfgefgkrgv
    gynvehlydaigeilgvkkewklvvvgagnigravanytvmkekgfriigifdsdpskig
    keaapgltvsdvselekfveehgveigviavpaehaqeiaerlekagikgilnfapvkik
    vsvpveniditaslrvltfeivrrns
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >5zz5C (C:)
    maekipkpvskrlvsyymclerlldegvevvsseelarrldlkasqirkdlsyfgefgkr
    gvgynvehlydaigeilgvkkewklvvvgagnigravanytvmkekgfriigifdsdpsk
    igkeaapgltvsdvselekfveehgveigviavpaehaqeiaerlekagikgilnfapvk
    ikvsvpveniditaslrvltfeivrrns
    

    Sequence, based on observed residues (ATOM records): (download)
    >5zz5C (C:)
    lvsyymclerlldnvehlydaigeilgvkkewklvvvgagnigravanytvmkekgfrii
    gifdsdpskigkeaapgltvsdvselekfveehgveigviavpaehaqeiaerlekagik
    gilnfapvkikvsvpveniditaslrvltfeivrrn
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >5zz5D (D:)
    maekipkpvskrlvsyymclerlldegvevvsseelarrldlkasqirkdlsyfgefgkr
    gvgynvehlydaigeilgvkkewklvvvgagnigravanytvmkekgfriigifdsdpsk
    igkeaapgltvsdvselekfveehgveigviavpaehaqeiaerlekagikgilnfapvk
    ikvsvpveniditaslrvltfeivrrns
    

    Sequence, based on observed residues (ATOM records): (download)
    >5zz5D (D:)
    pvskrlvsyymclerlldegvevvseelarrldlkasqirynvehlydaigeilgvkkew
    klvvvgagnigravanytvmkekgfriigifdsdpskigkeaapgltvsdvselekfvee
    hgveigviavpaehaqeiaerlekagikgilnfapvkikvsvpveniditaslrvltfei
    vrr