PDB entry 5zz4

View 5zz4 on RCSB PDB site
Description: Crystal structure of bruton's tyrosine kinase in complex with inhibitor 2e
Class: transferase/transferase inhibitor
Keywords: protein kinase, inhibitor complex, non-covalent, TRANSFERASE-TRANSFERASE INHIBITOR complex
Deposited on 2018-05-30, released 2018-09-26
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-09-26, with a file datestamp of 2018-09-21.
Experiment type: XRAY
Resolution: 2.9 Å
R-factor: N/A
AEROSPACI score: 0.14 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Tyrosine-protein kinase BTK
    Species: Homo sapiens [TaxId:9606]
    Gene: BTK, AGMX1, ATK, BPK
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5zz4a_
  • Chain 'B':
    Compound: Tyrosine-protein kinase BTK
    Species: Homo sapiens [TaxId:9606]
    Gene: BTK, AGMX1, ATK, BPK
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5zz4b_
  • Chain 'C':
    Compound: Tyrosine-protein kinase BTK
    Species: Homo sapiens [TaxId:9606]
    Gene: BTK, AGMX1, ATK, BPK
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5zz4c_
  • Chain 'D':
    Compound: Tyrosine-protein kinase BTK
    Species: Homo sapiens [TaxId:9606]
    Gene: BTK, AGMX1, ATK, BPK
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5zz4d_
  • Chain 'E':
    Compound: Tyrosine-protein kinase BTK
    Species: Homo sapiens [TaxId:9606]
    Gene: BTK, AGMX1, ATK, BPK
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5zz4e_
  • Chain 'F':
    Compound: Tyrosine-protein kinase BTK
    Species: Homo sapiens [TaxId:9606]
    Gene: BTK, AGMX1, ATK, BPK
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5zz4f_
  • Heterogens: 9M3

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5zz4A (A:)
    gamggsweidpkdltflkelgtgqfgvvkygkwrgqydvaikmikegsmsedefieeakv
    mmnlsheklvqlygvctkqrpifiiteymangcllnylremrhrfqtqqllemckdvcea
    meyleskqflhrdlaarnclvndqgvvkvsdfglsryvlddeytssvgskfpvrwsppev
    lmyskfssksdiwafgvlmweiyslgkmpyerftnsetaehiaqglrlyrphlasekvyt
    imyscwhekaderptfkillsnildvmd
    

    Sequence, based on observed residues (ATOM records): (download)
    >5zz4A (A:)
    weidpkdltflkelgtgqfgvvkygkwrgqydvaikmikegsmsedefieeakvmmnlsh
    eklvqlygvctkqrpifiiteymangcllnylremrhrfqtqqllemckdvceameyles
    kqflhrdlaarnclvndqgvvkvsdfglsryvlddeytssvgskfpvrwsppevlmyskf
    ssksdiwafgvlmweiyslgkmpyerftnsetaehiaqglrlyrphlasekvytimyscw
    hekaderptfkillsnildvm
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5zz4B (B:)
    gamggsweidpkdltflkelgtgqfgvvkygkwrgqydvaikmikegsmsedefieeakv
    mmnlsheklvqlygvctkqrpifiiteymangcllnylremrhrfqtqqllemckdvcea
    meyleskqflhrdlaarnclvndqgvvkvsdfglsryvlddeytssvgskfpvrwsppev
    lmyskfssksdiwafgvlmweiyslgkmpyerftnsetaehiaqglrlyrphlasekvyt
    imyscwhekaderptfkillsnildvmd
    

    Sequence, based on observed residues (ATOM records): (download)
    >5zz4B (B:)
    gsweidpkdltflkelgtgqfgvvkygkwrgqydvaikmikegsmsedefieeakvmmnl
    sheklvqlygvctkqrpifiiteymangcllnylremrhrfqtqqllemckdvceameyl
    eskqflhrdlaarnclvndqgvvkvsdfglsryvlddeytssvgskfpvrwsppevlmys
    kfssksdiwafgvlmweiyslgkmpyerftnsetaehiaqglrlyrphlasekvytimys
    cwhekaderptfkillsnildvm
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >5zz4C (C:)
    gamggsweidpkdltflkelgtgqfgvvkygkwrgqydvaikmikegsmsedefieeakv
    mmnlsheklvqlygvctkqrpifiiteymangcllnylremrhrfqtqqllemckdvcea
    meyleskqflhrdlaarnclvndqgvvkvsdfglsryvlddeytssvgskfpvrwsppev
    lmyskfssksdiwafgvlmweiyslgkmpyerftnsetaehiaqglrlyrphlasekvyt
    imyscwhekaderptfkillsnildvmd
    

    Sequence, based on observed residues (ATOM records): (download)
    >5zz4C (C:)
    sweidpkdltflkelgtgqfgvvkygkwrgqydvaikmikegsmsedefieeakvmmnls
    heklvqlygvctkqrpifiiteymangcllnylremrhrfqtqqllemckdvceameyle
    skqflhrdlaarnclvndqgvvkvsdfglsryvlddeytssvgskfpvrwsppevlmysk
    fssksdiwafgvlmweiyslgkmpyerftnsetaehiaqglrlyrphlasekvytimysc
    whekaderptfkillsnildvm
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >5zz4D (D:)
    gamggsweidpkdltflkelgtgqfgvvkygkwrgqydvaikmikegsmsedefieeakv
    mmnlsheklvqlygvctkqrpifiiteymangcllnylremrhrfqtqqllemckdvcea
    meyleskqflhrdlaarnclvndqgvvkvsdfglsryvlddeytssvgskfpvrwsppev
    lmyskfssksdiwafgvlmweiyslgkmpyerftnsetaehiaqglrlyrphlasekvyt
    imyscwhekaderptfkillsnildvmd
    

    Sequence, based on observed residues (ATOM records): (download)
    >5zz4D (D:)
    gsweidpkdltflkelgtgqfgvvkygkwrgqydvaikmikegsmsedefieeakvmmnl
    sheklvqlygvctkqrpifiiteymangcllnylremrhrfqtqqllemckdvceameyl
    eskqflhrdlaarnclvndqgvvkvsdfglsryvlddeytssvgskfpvrwsppevlmys
    kfssksdiwafgvlmweiyslgkmpyerftnsetaehiaqglrlyrphlasekvytimys
    cwhekaderptfkillsnildvm
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >5zz4E (E:)
    gamggsweidpkdltflkelgtgqfgvvkygkwrgqydvaikmikegsmsedefieeakv
    mmnlsheklvqlygvctkqrpifiiteymangcllnylremrhrfqtqqllemckdvcea
    meyleskqflhrdlaarnclvndqgvvkvsdfglsryvlddeytssvgskfpvrwsppev
    lmyskfssksdiwafgvlmweiyslgkmpyerftnsetaehiaqglrlyrphlasekvyt
    imyscwhekaderptfkillsnildvmd
    

    Sequence, based on observed residues (ATOM records): (download)
    >5zz4E (E:)
    sweidpkdltflkelgtgqfgvvkygkwrgqydvaikmikegsmsedefieeakvmmnls
    heklvqlygvctkqrpifiiteymangcllnylremrhrfqtqqllemckdvceameyle
    skqflhrdlaarnclvndqgvvkvsdfglsryvlddeytssvgskfpvrwsppevlmysk
    fssksdiwafgvlmweiyslgkmpyerftnsetaehiaqglrlyrphlasekvytimysc
    whekaderptfkillsnildvm
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >5zz4F (F:)
    gamggsweidpkdltflkelgtgqfgvvkygkwrgqydvaikmikegsmsedefieeakv
    mmnlsheklvqlygvctkqrpifiiteymangcllnylremrhrfqtqqllemckdvcea
    meyleskqflhrdlaarnclvndqgvvkvsdfglsryvlddeytssvgskfpvrwsppev
    lmyskfssksdiwafgvlmweiyslgkmpyerftnsetaehiaqglrlyrphlasekvyt
    imyscwhekaderptfkillsnildvmd
    

    Sequence, based on observed residues (ATOM records): (download)
    >5zz4F (F:)
    gsweidpkdltflkelgtgqfgvvkygkwrgqydvaikmikegsmsedefieeakvmmnl
    sheklvqlygvctkqrpifiiteymangcllnylremrhrfqtqqllemckdvceameyl
    eskqflhrdlaarnclvndqgvvkvsdfglsryvlddeytssvgskfpvrwsppevlmys
    kfssksdiwafgvlmweiyslgkmpyerftnsetaehiaqglrlyrphlasekvytimys
    cwhekaderptfkillsnildvm