PDB entry 5zz2

View 5zz2 on RCSB PDB site
Description: Crystal structure of PDE5 in complex with inhibitor LW1634
Class: hydrolase/hydrolase inhibitor
Keywords: PDE5 inhibitor LW1634, HYDROLASE-HYDROLASE INHIBITOR complex
Deposited on 2018-05-29, released 2018-09-19
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-09-19, with a file datestamp of 2018-09-14.
Experiment type: XRAY
Resolution: 2.6 Å
R-factor: N/A
AEROSPACI score: 0.2 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: cGMP-specific 3',5'-cyclic phosphodiesterase
    Species: Homo sapiens [TaxId:9606]
    Gene: PDE5A, PDE5
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5zz2a_
  • Heterogens: ZN, MG, SO4, 9M0, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5zz2A (A:)
    eetrelqslaaavvpsaqtlkitdfsfsdfelsdletalctirmftdlnlvqnfqmkhev
    lcrwilsvkknyrknvayhnwrhafntaqcmfaalkagkiqnkltdleilalliaalshd
    ldhrgvnnsyiqrsehplaqlychsimehhhfdqclmilnspgnqilsglsieeykttlk
    iikqailatdlalyikrrgeffelirknqfnledphqkelflamlmtacdlsaitkpwpi
    qqriaelvateffdqgdrerkelnieptdlmnrekknkipsmqvgfidaiclqlyealth
    vsedcfplldgcrknrqkwqalaeqq
    

    Sequence, based on observed residues (ATOM records): (download)
    >5zz2A (A:)
    eetrelqslaaavvpsaqtlkitdfsfsdfelsdletalctirmftdlnlvqnfqmkhev
    lcrwilsvkknyrknvayhnwrhafntaqcmfaalkagkiqnkltdleilalliaalshd
    ldhrgvnnsyiqchsimehhhfdqclmilnspgnqilsglsieeykttlkiikqailatd
    lalyikrrgeffelirknqfnledphqkelflamlmtacdlsaitkpwpiqqriaelvat
    effdqgekknkipsmqvgfidaiclqlyealthvsedcfplldgcrknrqkwqalaeqq