PDB entry 5zye

View 5zye on RCSB PDB site
Description: Crystal Structure of Glucose Isomerase Soaked with Mn2+ and Glucose
Class: isomerase
Keywords: glucose isomerase, xylose isomerase, ISOMERASE
Deposited on 2018-05-24, released 2018-11-28
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-11-28, with a file datestamp of 2018-11-23.
Experiment type: XRAY
Resolution: 1.4 Å
R-factor: N/A
AEROSPACI score: 0.54 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: xylose isomerase
    Species: Streptomyces rubiginosus [TaxId:1929]
    Gene: XYLA
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5zyea_
  • Heterogens: MN, GLC, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5zyeA (A:)
    mnyqptpedrftfglwtvgwqgrdpfgdatrraldpvesvrrlaelgahgvtfhdddlip
    fgssdsereehvkrfrqalddtgmkvpmattnlfthpvfkdggftandrdvrryalrkti
    rnidlavelgaetyvawggregaesggakdvrdaldrmkeafdllgeyvtsqgydirfai
    epkpneprgdillptvghalafierlerpelygvnpevgheqmaglnfphgiaqalwagk
    lfhidlngqngikydqdlrfgagdlraafwlvdllesagysgprhfdfkpprtedfdgvw
    asaagcmrnylilkeraaafradpevqealrasrldelarptaadglqallddrsafeef
    dvdaaaargmaferldqlamdhllgarg
    

    Sequence, based on observed residues (ATOM records): (download)
    >5zyeA (A:)
    yqptpedrftfglwtvgwqgrdpfgdatrraldpvesvrrlaelgahgvtfhdddlipfg
    ssdsereehvkrfrqalddtgmkvpmattnlfthpvfkdggftandrdvrryalrktirn
    idlavelgaetyvawggregaesggakdvrdaldrmkeafdllgeyvtsqgydirfaiep
    kpneprgdillptvghalafierlerpelygvnpevgheqmaglnfphgiaqalwagklf
    hidlngqngikydqdlrfgagdlraafwlvdllesagysgprhfdfkpprtedfdgvwas
    aagcmrnylilkeraaafradpevqealrasrldelarptaadglqallddrsafeefdv
    daaaargmaferldqlamdhllga