PDB entry 5zxb

View 5zxb on RCSB PDB site
Description: Crystal structure of ACK1 with compound 10d
Class: transferase
Keywords: inhibitor, Kinase, TRANSFERASE
Deposited on 2018-05-18, released 2018-09-26
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-09-26, with a file datestamp of 2018-09-21.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: N/A
AEROSPACI score: 0.27 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Activated CDC42 kinase 1
    Species: Homo sapiens [TaxId:9606]
    Gene: TNK2, ACK1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5zxba_
  • Chain 'B':
    Compound: Activated CDC42 kinase 1
    Species: Homo sapiens [TaxId:9606]
    Gene: TNK2, ACK1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5zxbb_
  • Heterogens: 9KO, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5zxbA (A:)
    ltcligekdlrlleklgdgsfgvvrrgewdapsgktvsvavkclkpdvlsqpeamddfir
    evnamhsldhrnlirlygvvltppmkmvtelaplgslldrlrkhqghfllgtlsryavqv
    aegmgyleskrfihrdlaarnlllatrdlvkigdfglmralpqnddhyvmqehrkvpfaw
    capeslktrtfshasdtwmfgvtlwemftygqepwiglngsqilhkidkegerlprpedc
    pqdiynvmvqcwahkpedrptfvalrdflleaqpt
    

    Sequence, based on observed residues (ATOM records): (download)
    >5zxbA (A:)
    ltcligekdlrlleklgdgvvrrgewdapsgktvsvavkclamddfirevnamhsldhrn
    lirlygvvltppmkmvtelaplgslldrlrkhqghfllgtlsryavqvaegmgyleskrf
    ihrdlaarnlllatrdlvkigdfpfawcapeslktrtfshasdtwmfgvtlwemftygqe
    pwiglngsqilhkidkegerlprpedcpqdiynvmvqcwahkpedrptfvalrdflleaq
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5zxbB (B:)
    ltcligekdlrlleklgdgsfgvvrrgewdapsgktvsvavkclkpdvlsqpeamddfir
    evnamhsldhrnlirlygvvltppmkmvtelaplgslldrlrkhqghfllgtlsryavqv
    aegmgyleskrfihrdlaarnlllatrdlvkigdfglmralpqnddhyvmqehrkvpfaw
    capeslktrtfshasdtwmfgvtlwemftygqepwiglngsqilhkidkegerlprpedc
    pqdiynvmvqcwahkpedrptfvalrdflleaqpt
    

    Sequence, based on observed residues (ATOM records): (download)
    >5zxbB (B:)
    ltcligekdlrlleklgdvvrrgewdapsgktvsvavkclqpeamddfirevnamhsldh
    rnlirlygvvltppmkmvtelaplgslldrlrkhqghflgtlsryavqvaegmgyleskr
    fihrdlaarnlllatrdlvkigdfpfawcapeslktrtfshasdtwmfgvtlwemftygq
    epwiglngsqilhkidkegerlprpedcpqdiynvmvqcwahkpedrptfvalrdfllea
    q