PDB entry 5zws

View 5zws on RCSB PDB site
Description: Crystal structure of apo-acyl carrier protein from Leishmania major
Class: lipid binding protein
Keywords: Leishmania major; Acyl carrier protein; Fatty acid biosynthesis, LIPID BINDING PROTEIN
Deposited on 2018-05-16, released 2019-01-16
The last revision prior to the SCOPe 2.08 freeze date was dated 2019-01-16, with a file datestamp of 2019-01-11.
Experiment type: XRAY
Resolution: 2 Å
R-factor: N/A
AEROSPACI score: 0.32 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Acyl carrier protein
  Species: Leishmania major [TaxId:5664]
  Gene: ACP, LMJF_27_0290
  Database cross-references and differences (RAF-indexed):
  • Uniprot E9AD06 (5-82)
    • expression tag (0-4)
  Domains in SCOPe 2.08: d5zwsa1, d5zwsa2
• Chain 'B':
  Compound: Acyl carrier protein
  Species: Leishmania major [TaxId:5664]
  Gene: ACP, LMJF_27_0290
  Database cross-references and differences (RAF-indexed):
  • Uniprot E9AD06 (5-82)
    • expression tag (0-4)
  Domains in SCOPe 2.08: d5zwsb1, d5zwsb2
• Heterogens: HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >5zwsA (A:)
  gshmndvltrvlevvknfekvdaskvtpeshfvkdlglnsldvvevvfaieqefildipd
  hdaekiqsipdaveyiaqnpmak
  

  
  
• Chain 'B':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >5zwsB (B:)
  gshmndvltrvlevvknfekvdaskvtpeshfvkdlglnsldvvevvfaieqefildipd
  hdaekiqsipdaveyiaqnpmak