PDB entry 5zur

View 5zur on RCSB PDB site
Description: Achromobacter Dh1f Bacterioferritin
Class: metal binding protein
Keywords: Bacteriferritin, heme, iron, METAL BINDING PROTEIN
Deposited on 2018-05-08, released 2018-09-05
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-09-05, with a file datestamp of 2018-08-31.
Experiment type: XRAY
Resolution: 1.95 Å
R-factor: N/A
AEROSPACI score: 0.33 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: bacterioferritin
    Species: Achromobacter sp. DH1f [TaxId:1397275]
    Database cross-references and differences (RAF-indexed):
    • PDB 5ZUR (0-End)
    Domains in SCOPe 2.07: d5zura_
  • Chain 'B':
    Compound: bacterioferritin
    Species: Achromobacter sp. DH1f [TaxId:1397275]
    Database cross-references and differences (RAF-indexed):
    • PDB 5ZUR (0-End)
    Domains in SCOPe 2.07: d5zurb_
  • Chain 'C':
    Compound: bacterioferritin
    Species: Achromobacter sp. DH1f [TaxId:1397275]
    Database cross-references and differences (RAF-indexed):
    • PDB 5ZUR (0-End)
    Domains in SCOPe 2.07: d5zurc_
  • Heterogens: HEM, FE2, PEG, BA, CL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5zurA (A:)
    mkgdktviqflnkqltneltainqyflharmlnhwgfdklgkheyeesigemkhadrlia
    rifmldglpnlqdlhklligedvpellacdlkleqaahatvreaiahcesvrdyvsrdlf
    qdilddteehidyletqidlidkvglqnylqsqmsvpe
    

    Sequence, based on observed residues (ATOM records): (download)
    >5zurA (A:)
    mkgdktviqflnkqltneltainqyflharmlnhwgfdklgkheyeesigemkhadrlia
    rifmldglpnlqdlhklligedvpellacdlkleqaahatvreaiahcesvrdyvsrdlf
    qdilddteehidyletqidlidkvglqnylqsqm
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5zurB (B:)
    mkgdktviqflnkqltneltainqyflharmlnhwgfdklgkheyeesigemkhadrlia
    rifmldglpnlqdlhklligedvpellacdlkleqaahatvreaiahcesvrdyvsrdlf
    qdilddteehidyletqidlidkvglqnylqsqmsvpe
    

    Sequence, based on observed residues (ATOM records): (download)
    >5zurB (B:)
    mkgdktviqflnkqltneltainqyflharmlnhwgfdklgkheyeesigemkhadrlia
    rifmldglpnlqdlhklligedvpellacdlkleqaahatvreaiahcesvrdyvsrdlf
    qdilddteehidyletqidlidkvglqnylqsqms
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >5zurC (C:)
    mkgdktviqflnkqltneltainqyflharmlnhwgfdklgkheyeesigemkhadrlia
    rifmldglpnlqdlhklligedvpellacdlkleqaahatvreaiahcesvrdyvsrdlf
    qdilddteehidyletqidlidkvglqnylqsqmsvpe
    

    Sequence, based on observed residues (ATOM records): (download)
    >5zurC (C:)
    mkgdktviqflnkqltneltainqyflharmlnhwgfdklgkheyeesigemkhadrlia
    rifmldglpnlqdlhklligedvpellacdlkleqaahatvreaiahcesvrdyvsrdlf
    qdilddteehidyletqidlidkvglqnylqsqm