PDB entry 5ztp

View 5ztp on RCSB PDB site
Description: Carbonic anhydrase from Glaciozyma antarctica
Class: lyase
Keywords: Carbonic anhydrase, psychrophilic enzyme, lyase
Deposited on 2018-05-04, released 2018-05-23
The last revision prior to the SCOPe 2.08 freeze date was dated 2018-05-23, with a file datestamp of 2018-05-18.
Experiment type: XRAY
Resolution: 2.96 Å
R-factor: N/A
AEROSPACI score: 0.13 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: carbonic anhydrase
    Species: Glaciozyma antarctica [TaxId:105987]
    Database cross-references and differences (RAF-indexed):
    • PDB 5ZTP (0-168)
    Domains in SCOPe 2.08: d5ztpa_
  • Chain 'B':
    Compound: carbonic anhydrase
    Species: Glaciozyma antarctica [TaxId:105987]
    Database cross-references and differences (RAF-indexed):
    • PDB 5ZTP (0-168)
    Domains in SCOPe 2.08: d5ztpb_
  • Heterogens: SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >5ztpA (A:)
msyaeqslpaaneayvaafgdkgslplppgkrvaivgcmdarldtfgatglhegdahhir
naggrasdalrslvisqellgtrevivihhtdcgmltfrsdqlhglvkkrvahehfaavd
slaclefpdvdesikedvaflknhplilpetvisgyryevetgklvkia

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >5ztpB (B:)
msyaeqslpaaneayvaafgdkgslplppgkrvaivgcmdarldtfgatglhegdahhir
naggrasdalrslvisqellgtrevivihhtdcgmltfrsdqlhglvkkrvahehfaavd
slaclefpdvdesikedvaflknhplilpetvisgyryevetgklvkia