PDB entry 5ztd

View 5ztd on RCSB PDB site
Description: X-ray Crystal Structure of Pseudoazurin Met16Val Variant
Class: electron transport
Keywords: electron transport
Deposited on 2018-05-02, released 2019-05-15
The last revision prior to the SCOPe 2.07 freeze date was dated 2019-05-15, with a file datestamp of 2019-05-10.
Experiment type: XRAY
Resolution: 1.05 Å
R-factor: N/A
AEROSPACI score: 0.77 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: pseudoazurin
    Species: Achromobacter cycloclastes [TaxId:223]
    Gene: BCP
    Database cross-references and differences (RAF-indexed):
    • Uniprot P19567 (0-123)
      • engineered mutation (15)
    Domains in SCOPe 2.07: d5ztda_
  • Chain 'B':
    Compound: pseudoazurin
    Species: Achromobacter cycloclastes [TaxId:223]
    Gene: BCP
    Database cross-references and differences (RAF-indexed):
    • Uniprot P19567 (0-123)
      • engineered mutation (15)
    Domains in SCOPe 2.07: d5ztdb_
  • Heterogens: CU, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5ztdA (A:)
    adfevhmlnkgkdgavvfepaslkvapgdtvtfiptdkghnvetikgmipdgaeafkski
    nenykvtftapgvygvkctphygmgmvgvvqvgdapanleavkgaknpkkaqerldaala
    algn
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5ztdB (B:)
    adfevhmlnkgkdgavvfepaslkvapgdtvtfiptdkghnvetikgmipdgaeafkski
    nenykvtftapgvygvkctphygmgmvgvvqvgdapanleavkgaknpkkaqerldaala
    algn