PDB entry 5zrq

View 5zrq on RCSB PDB site
Description: Crystal structure of PET-degrading cutinase Cut190 S176A/S226P/R228S mutant in Zn(2+)-bound state
Class: hydrolase
Keywords: polyesterase, alpha/beta-hydrolase fold, protein engineering, thermostability, hydrolase
Deposited on 2018-04-25, released 2018-09-12
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-09-12, with a file datestamp of 2018-09-07.
Experiment type: XRAY
Resolution: 1.12 Å
R-factor: N/A
AEROSPACI score: 0.71 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Alpha/beta hydrolase family protein
    Species: Saccharomonospora viridis [TaxId:1852]
    Gene: Cut190, SAMN02982918_2340
    Database cross-references and differences (RAF-indexed):
    • Uniprot W0TJ64 (2-261)
      • expression tag (0-1)
      • engineered mutation (133)
      • engineered mutation (183)
      • engineered mutation (185)
      • expression tag (262)
    Domains in SCOPe 2.07: d5zrqa1, d5zrqa2
  • Heterogens: ZN, CA, SO4, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5zrqA (A:)
    gpqdnpyergpdptedsieairgpfsvatervssfasgfgggtiyypretdegtfgavav
    apgftasqgsmswygervasqgfivftidtntrldqpgqrgrqllaaldylversdrkvr
    erldpnrlavmghamggggsleatvmrpslkasipltpwnldktwgqvqvptfiigaeld
    tiapvsthakpfyeslpsslpkaymeldgathfapnipnttiakyviswlkrfvdedtry
    sqflcpnptdraieeyrstcpykln
    

    Sequence, based on observed residues (ATOM records): (download)
    >5zrqA (A:)
    gpqdnpyergpdptedsieairgpfsvatervssfasgfgggtiyypretdegtfgavav
    apgftasqgsmswygervasqgfivftidtntrldqpgqrgrqllaaldylversdrkvr
    erldpnrlavmghamggggsleatvmrpslkasipltpwnldktwgqvqvptfiigaeld
    tiapvsthakpfyeslpsslpkaymeldgathfapnipnttiakyviswlkrfvdedtry
    sqflcpnptdraieeyrstcpyk