PDB entry 5zo8

View 5zo8 on RCSB PDB site
Description: Eg5 motor domain in complex with STLC-type inhibitor PVEI0021 (P21 type)
Class: cell cycle
Keywords: motor domain ATP binding, CELL CYCLE
Deposited on 2018-04-12, released 2018-10-10
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-10-10, with a file datestamp of 2018-10-05.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: N/A
AEROSPACI score: 0.27 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Kinesin-like protein KIF11
    Species: Homo sapiens [TaxId:9606]
    Gene: KIF11, EG5, KNSL1, TRIP5
    Database cross-references and differences (RAF-indexed):
    • Uniprot P52732 (7-End)
      • expression tag (6)
    Domains in SCOPe 2.07: d5zo8a1, d5zo8a2
  • Chain 'B':
    Compound: Kinesin-like protein KIF11
    Species: Homo sapiens [TaxId:9606]
    Gene: KIF11, EG5, KNSL1, TRIP5
    Database cross-references and differences (RAF-indexed):
    • Uniprot P52732 (7-End)
      • expression tag (6)
    Domains in SCOPe 2.07: d5zo8b1, d5zo8b2
  • Heterogens: ADP, MG, 4C5, SO4, NA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5zo8A (A:)
    mnhkvhmkniqvvvrcrpfnlaerkasahsivecdpvrkevsvrtggladkssrktytfd
    mvfgastkqidvyrsvvcpildevimgynctifaygqtgtgktftmegerspneeytwee
    dplagiiprtlhqifekltdngtefsvkvslleiyneelfdllnpssdvserlqmfddpr
    nkrgviikgleeitvhnkdevyqilekgaakrttaatlmnayssrshsvfsvtihmkett
    idgeelvkigklnlvdlagsenigrsgavdkrareagninqslltlgrvitalvertphv
    pyreskltrilqdslggrtrtsiiatispaslnleetlstleyahraknilnkpevnqkl
    qhhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >5zo8A (A:)
    mkniqvvvrcrpfnlaerkasahsivecdpvrkevsvrtssrktytfdmvfgastkqidv
    yrsvvcpildevimgynctifaygqtgtgktftmegerspneeytweedplagiiprtlh
    qifekltdngtefsvkvslleiyneelfdllnpssdvserlqmfddprnkrgviikglee
    itvhnkdevyqilekgaakrttaatlmnayssrshsvfsvtihmkettidgeelvkigkl
    nlvdlagsenninqslltlgrvitalvertphvpyreskltrilqdslggrtrtsiiati
    spaslnleetlstleyahraknilnkpevnq
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5zo8B (B:)
    mnhkvhmkniqvvvrcrpfnlaerkasahsivecdpvrkevsvrtggladkssrktytfd
    mvfgastkqidvyrsvvcpildevimgynctifaygqtgtgktftmegerspneeytwee
    dplagiiprtlhqifekltdngtefsvkvslleiyneelfdllnpssdvserlqmfddpr
    nkrgviikgleeitvhnkdevyqilekgaakrttaatlmnayssrshsvfsvtihmkett
    idgeelvkigklnlvdlagsenigrsgavdkrareagninqslltlgrvitalvertphv
    pyreskltrilqdslggrtrtsiiatispaslnleetlstleyahraknilnkpevnqkl
    qhhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >5zo8B (B:)
    mkniqvvvrcrpfnlaerkasahsivecdpvrkevsvrtssrktytfdmvfgastkqidv
    yrsvvcpildevimgynctifaygqtgtgktftmegerspneeytweedplagiiprtlh
    qifekltdngtefsvkvslleiyneelfdllnpssdvserlqmfddprnkrgviikglee
    itvhnkdevyqilekgaakrttaatlmnayssrshsvfsvtihmkettidgeelvkigkl
    nlvdlagsenninqslltlgrvitalvertphvpyreskltrilqdslggrtrtsiiati
    spaslnleetlstleyahraknilnkpevnq