PDB entry 5zo7

View 5zo7 on RCSB PDB site
Description: Kinesin spindle protein Eg5 in complex with STLC-type inhibitor PVEI0138
Class: cell cycle
Keywords: motor domain, ATP binding, CELL CYCLE
Deposited on 2018-04-12, released 2018-10-10
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-10-10, with a file datestamp of 2018-10-05.
Experiment type: XRAY
Resolution: 2.6 Å
R-factor: N/A
AEROSPACI score: 0.19 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Kinesin-like protein KIF11
    Species: Homo sapiens [TaxId:9606]
    Gene: KIF11, EG5, KNSL1, TRIP5
    Database cross-references and differences (RAF-indexed):
    • Uniprot P52732 (7-End)
      • expression tag (6)
    Domains in SCOPe 2.07: d5zo7a1, d5zo7a2
  • Chain 'B':
    Compound: Kinesin-like protein KIF11
    Species: Homo sapiens [TaxId:9606]
    Gene: KIF11, EG5, KNSL1, TRIP5
    Database cross-references and differences (RAF-indexed):
    • Uniprot P52732 (7-End)
      • expression tag (6)
    Domains in SCOPe 2.07: d5zo7b1, d5zo7b2
  • Heterogens: ADP, MG, 5C5, SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5zo7A (A:)
    mnhkvhmkniqvvvrcrpfnlaerkasahsivecdpvrkevsvrtggladkssrktytfd
    mvfgastkqidvyrsvvcpildevimgynctifaygqtgtgktftmegerspneeytwee
    dplagiiprtlhqifekltdngtefsvkvslleiyneelfdllnpssdvserlqmfddpr
    nkrgviikgleeitvhnkdevyqilekgaakrttaatlmnayssrshsvfsvtihmkett
    idgeelvkigklnlvdlagsenigrsgavdkrareagninqslltlgrvitalvertphv
    pyreskltrilqdslggrtrtsiiatispaslnleetlstleyahraknilnkpevnqkl
    qhhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >5zo7A (A:)
    mkniqvvvrcrpfnlaerkasahsivecdpvrkevsvrtdkssrktytfdmvfgastkqi
    dvyrsvvcpildevimgynctifaygqtgtgktftmegerspneeytweedplagiiprt
    lhqifekltdngtefsvkvslleiyneelfdllnpssdvserlqmfddprnkrgviikgl
    eeitvhnkdevyqilekgaakrttaatlmnayssrshsvfsvtihmkettidgeelvkig
    klnlvdlagsenninqslltlgrvitalvertphvpyreskltrilqdslggrtrtsiia
    tispaslnleetlstleyahraknilnkpevn
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5zo7B (B:)
    mnhkvhmkniqvvvrcrpfnlaerkasahsivecdpvrkevsvrtggladkssrktytfd
    mvfgastkqidvyrsvvcpildevimgynctifaygqtgtgktftmegerspneeytwee
    dplagiiprtlhqifekltdngtefsvkvslleiyneelfdllnpssdvserlqmfddpr
    nkrgviikgleeitvhnkdevyqilekgaakrttaatlmnayssrshsvfsvtihmkett
    idgeelvkigklnlvdlagsenigrsgavdkrareagninqslltlgrvitalvertphv
    pyreskltrilqdslggrtrtsiiatispaslnleetlstleyahraknilnkpevnqkl
    qhhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >5zo7B (B:)
    mkniqvvvrcrpfnlaerkasahsivecdpvrkevsvrtdkssrktytfdmvfgastkqi
    dvyrsvvcpildevimgynctifaygqtgtgktftmegerspneeytweedplagiiprt
    lhqifekltdngtefsvkvslleiyneelfdllnpssdvserlqmfddprnkrgviikgl
    eeitvhnkdevyqilekgaakrttaatlmnayssrshsvfsvtihmkettidgeelvkig
    klnlvdlagsenninqslltlgrvitalvertphvpyreskltrilqdslggrtrtsiia
    tispaslnleetlstleyahraknilnkpevn