PDB entry 5zlp

View 5zlp on RCSB PDB site
Description: Crystal structure of glutamine synthetase from helicobacter pylori
Class: ligase
Keywords: glutamine synthetase, enzyme, GS, helicobacter pylori, STRUCTURAL PROTEIN, LIGASE
Deposited on 2018-03-29, released 2018-08-29
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-08-29, with a file datestamp of 2018-08-24.
Experiment type: XRAY
Resolution: 2.93 Å
R-factor: N/A
AEROSPACI score: 0.14 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: glutamine synthetase
    Species: Helicobacter pylori (strain ATCC 700392 / 26695) [TaxId:85962]
    Gene: glnA, HP_0512
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5zlpa1, d5zlpa2
  • Chain 'B':
    Compound: glutamine synthetase
    Species: Helicobacter pylori (strain ATCC 700392 / 26695) [TaxId:85962]
    Gene: glnA, HP_0512
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5zlpb1, d5zlpb2
  • Chain 'C':
    Compound: glutamine synthetase
    Species: Helicobacter pylori (strain ATCC 700392 / 26695) [TaxId:85962]
    Gene: glnA, HP_0512
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5zlpc1, d5zlpc2
  • Chain 'D':
    Compound: glutamine synthetase
    Species: Helicobacter pylori (strain ATCC 700392 / 26695) [TaxId:85962]
    Gene: glnA, HP_0512
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5zlpd1, d5zlpd2
  • Chain 'E':
    Compound: glutamine synthetase
    Species: Helicobacter pylori (strain ATCC 700392 / 26695) [TaxId:85962]
    Gene: glnA, HP_0512
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5zlpe1, d5zlpe2
  • Chain 'F':
    Compound: glutamine synthetase
    Species: Helicobacter pylori (strain ATCC 700392 / 26695) [TaxId:85962]
    Gene: glnA, HP_0512
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5zlpf1, d5zlpf2
  • Chain 'G':
    Compound: glutamine synthetase
    Species: Helicobacter pylori (strain ATCC 700392 / 26695) [TaxId:85962]
    Gene: glnA, HP_0512
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5zlpg1, d5zlpg2
  • Chain 'H':
    Compound: glutamine synthetase
    Species: Helicobacter pylori (strain ATCC 700392 / 26695) [TaxId:85962]
    Gene: glnA, HP_0512
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5zlph1, d5zlph2
  • Chain 'I':
    Compound: glutamine synthetase
    Species: Helicobacter pylori (strain ATCC 700392 / 26695) [TaxId:85962]
    Gene: glnA, HP_0512
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5zlpi1, d5zlpi2
  • Chain 'J':
    Compound: glutamine synthetase
    Species: Helicobacter pylori (strain ATCC 700392 / 26695) [TaxId:85962]
    Gene: glnA, HP_0512
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5zlpj1, d5zlpj2
  • Chain 'K':
    Compound: glutamine synthetase
    Species: Helicobacter pylori (strain ATCC 700392 / 26695) [TaxId:85962]
    Gene: glnA, HP_0512
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5zlpk1, d5zlpk2
  • Chain 'L':
    Compound: glutamine synthetase
    Species: Helicobacter pylori (strain ATCC 700392 / 26695) [TaxId:85962]
    Gene: glnA, HP_0512
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5zlpl1, d5zlpl2
  • Heterogens: ATP, ADP, PPQ, MG, P3P, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5zlpA (A:)
    mivrtqnseskikeffefckenevefvdfrfsdikgtwnhiaysfgalthgmlkegipfd
    ascfkgwqgiehsdmiltpdlvryfidpfsadvsvvvfcdvydvyknqpyekcprsiakk
    alqhlkdsglgdvayfgaeneffifdsikikdasnsqyyevdseegewnrdrsfengvnf
    ghrpgkqggympvpptdtmmdirteivkvlnqvgletfvvhhevaqaqgevgvkfgdlve
    aadnvqklkyvvkmvahlngktatfmpkplygdngsgmhthvsvwknnenlfsgetykgl
    sefalhflggvlrharglaaftnastnsykrlipgyeapsiltysannrsasvripygis
    knsarfefrfpdsssnpylafaailmagmdgvknkidpgeamdinlfkltldeirekgik
    qmphtlrrsleemladkqylkesqvfseefiqayqslkfnaevfpweskphpfefittys
    c
    

    Sequence, based on observed residues (ATOM records): (download)
    >5zlpA (A:)
    qnseskikeffefckenevefvdfrfsdikgtwnhiaysfgalthgmlkegipfdascfk
    gwqgiehsdmiltpdlvryfidpfsadvsvvvfcdvydvyknqpyekcprsiakkalqhl
    kdsglgdvayfgaeneffifdsikikdasnsqyyevdseegewnrdrsfengvnfghrpg
    kqggympvpptdtmmdirteivkvlnqvgletfvvhhevaqaqgevgvkfgdlveaadnv
    qklkyvvkmvahlngktatfmpkplygdngsgmhthvsvwknnenlfsgetykglsefal
    hflggvlrharglaaftnastnsykrlipgyeapsiltysannrsasvripygisknsar
    fefrfpdsssnpylafaailmagmdgvknkidpgeamdinlfkltldeirekgikqmpht
    lrrsleemladkqylkesqvfseefiqayqslkfnaevfpweskphpfefittysc
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5zlpB (B:)
    mivrtqnseskikeffefckenevefvdfrfsdikgtwnhiaysfgalthgmlkegipfd
    ascfkgwqgiehsdmiltpdlvryfidpfsadvsvvvfcdvydvyknqpyekcprsiakk
    alqhlkdsglgdvayfgaeneffifdsikikdasnsqyyevdseegewnrdrsfengvnf
    ghrpgkqggympvpptdtmmdirteivkvlnqvgletfvvhhevaqaqgevgvkfgdlve
    aadnvqklkyvvkmvahlngktatfmpkplygdngsgmhthvsvwknnenlfsgetykgl
    sefalhflggvlrharglaaftnastnsykrlipgyeapsiltysannrsasvripygis
    knsarfefrfpdsssnpylafaailmagmdgvknkidpgeamdinlfkltldeirekgik
    qmphtlrrsleemladkqylkesqvfseefiqayqslkfnaevfpweskphpfefittys
    c
    

    Sequence, based on observed residues (ATOM records): (download)
    >5zlpB (B:)
    nseskikeffefckenevefvdfrfsdikgtwnhiaysfgalthgmlkegipfdascfkg
    wqgiehsdmiltpdlvryfidpfsadvsvvvfcdvydvyknqpyekcprsiakkalqhlk
    dsglgdvayfgaeneffifdsikikdasnsqyyevdseegewnrdrsfengvnfghrpgk
    qggympvpptdtmmdirteivkvlnqvgletfvvhhevaqaqgevgvkfgdlveaadnvq
    klkyvvkmvahlngktatfmpkplygdngsgmhthvsvwknnenlfsgetykglsefalh
    flggvlrharglaaftnastnsykrlipgyeapsiltysannrsasvripygisknsarf
    efrfpdsssnpylafaailmagmdgvknkidpgeamdinlfkltldeirekgikqmphtl
    rrsleemladkqylkesqvfseefiqayqslkfnaevfpweskphpfefittysc
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >5zlpC (C:)
    mivrtqnseskikeffefckenevefvdfrfsdikgtwnhiaysfgalthgmlkegipfd
    ascfkgwqgiehsdmiltpdlvryfidpfsadvsvvvfcdvydvyknqpyekcprsiakk
    alqhlkdsglgdvayfgaeneffifdsikikdasnsqyyevdseegewnrdrsfengvnf
    ghrpgkqggympvpptdtmmdirteivkvlnqvgletfvvhhevaqaqgevgvkfgdlve
    aadnvqklkyvvkmvahlngktatfmpkplygdngsgmhthvsvwknnenlfsgetykgl
    sefalhflggvlrharglaaftnastnsykrlipgyeapsiltysannrsasvripygis
    knsarfefrfpdsssnpylafaailmagmdgvknkidpgeamdinlfkltldeirekgik
    qmphtlrrsleemladkqylkesqvfseefiqayqslkfnaevfpweskphpfefittys
    c
    

    Sequence, based on observed residues (ATOM records): (download)
    >5zlpC (C:)
    seskikeffefckenevefvdfrfsdikgtwnhiaysfgalthgmlkegipfdascfkgw
    qgiehsdmiltpdlvryfidpfsadvsvvvfcdvydvyknqpyekcprsiakkalqhlkd
    sglgdvayfgaeneffifdsikikdasnsqyyevdseegewnrdrsfengvnfghrpgkq
    ggympvpptdtmmdirteivkvlnqvgletfvvhhevaqaqgevgvkfgdlveaadnvqk
    lkyvvkmvahlngktatfmpkplygdngsgmhthvsvwknnenlfsgetykglsefalhf
    lggvlrharglaaftnastnsykrlipgyeapsiltysannrsasvripygisknsarfe
    frfpdsssnpylafaailmagmdgvknkidpgeamdinlfkltldeirekgikqmphtlr
    rsleemladkqylkesqvfseefiqayqslkfnaevfpweskphpfefittysc
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >5zlpD (D:)
    mivrtqnseskikeffefckenevefvdfrfsdikgtwnhiaysfgalthgmlkegipfd
    ascfkgwqgiehsdmiltpdlvryfidpfsadvsvvvfcdvydvyknqpyekcprsiakk
    alqhlkdsglgdvayfgaeneffifdsikikdasnsqyyevdseegewnrdrsfengvnf
    ghrpgkqggympvpptdtmmdirteivkvlnqvgletfvvhhevaqaqgevgvkfgdlve
    aadnvqklkyvvkmvahlngktatfmpkplygdngsgmhthvsvwknnenlfsgetykgl
    sefalhflggvlrharglaaftnastnsykrlipgyeapsiltysannrsasvripygis
    knsarfefrfpdsssnpylafaailmagmdgvknkidpgeamdinlfkltldeirekgik
    qmphtlrrsleemladkqylkesqvfseefiqayqslkfnaevfpweskphpfefittys
    c
    

    Sequence, based on observed residues (ATOM records): (download)
    >5zlpD (D:)
    qnseskikeffefckenevefvdfrfsdikgtwnhiaysfgalthgmlkegipfdascfk
    gwqgiehsdmiltpdlvryfidpfsadvsvvvfcdvydvyknqpyekcprsiakkalqhl
    kdsglgdvayfgaeneffifdsikikdasnsqyyevdseegewnrdrsfengvnfghrpg
    kqggympvpptdtmmdirteivkvlnqvgletfvvhhevaqaqgevgvkfgdlveaadnv
    qklkyvvkmvahlngktatfmpkplygdngsgmhthvsvwknnenlfsgetykglsefal
    hflggvlrharglaaftnastnsykrlipgyeapsiltysannrsasvripygisknsar
    fefrfpdsssnpylafaailmagmdgvknkidpgeamdinlfkltldeirekgikqmpht
    lrrsleemladkqylkesqvfseefiqayqslkfnaevfpweskphpfefittysc
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >5zlpE (E:)
    mivrtqnseskikeffefckenevefvdfrfsdikgtwnhiaysfgalthgmlkegipfd
    ascfkgwqgiehsdmiltpdlvryfidpfsadvsvvvfcdvydvyknqpyekcprsiakk
    alqhlkdsglgdvayfgaeneffifdsikikdasnsqyyevdseegewnrdrsfengvnf
    ghrpgkqggympvpptdtmmdirteivkvlnqvgletfvvhhevaqaqgevgvkfgdlve
    aadnvqklkyvvkmvahlngktatfmpkplygdngsgmhthvsvwknnenlfsgetykgl
    sefalhflggvlrharglaaftnastnsykrlipgyeapsiltysannrsasvripygis
    knsarfefrfpdsssnpylafaailmagmdgvknkidpgeamdinlfkltldeirekgik
    qmphtlrrsleemladkqylkesqvfseefiqayqslkfnaevfpweskphpfefittys
    c
    

    Sequence, based on observed residues (ATOM records): (download)
    >5zlpE (E:)
    eskikeffefckenevefvdfrfsdikgtwnhiaysfgalthgmlkegipfdascfkgwq
    giehsdmiltpdlvryfidpfsadvsvvvfcdvydvyknqpyekcprsiakkalqhlkds
    glgdvayfgaeneffifdsikikdasnsqyyevdseegewnrdrsfengvnfghrpgkqg
    gympvpptdtmmdirteivkvlnqvgletfvvhhevaqaqgevgvkfgdlveaadnvqkl
    kyvvkmvahlngktatfmpkplygdngsgmhthvsvwknnenlfsgetykglsefalhfl
    ggvlrharglaaftnastnsykrlipgyeapsiltysannrsasvripygisknsarfef
    rfpdsssnpylafaailmagmdgvknkidpgeamdinlfkltldeirekgikqmphtlrr
    sleemladkqylkesqvfseefiqayqslkfnaevfpweskphpfefittysc
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >5zlpF (F:)
    mivrtqnseskikeffefckenevefvdfrfsdikgtwnhiaysfgalthgmlkegipfd
    ascfkgwqgiehsdmiltpdlvryfidpfsadvsvvvfcdvydvyknqpyekcprsiakk
    alqhlkdsglgdvayfgaeneffifdsikikdasnsqyyevdseegewnrdrsfengvnf
    ghrpgkqggympvpptdtmmdirteivkvlnqvgletfvvhhevaqaqgevgvkfgdlve
    aadnvqklkyvvkmvahlngktatfmpkplygdngsgmhthvsvwknnenlfsgetykgl
    sefalhflggvlrharglaaftnastnsykrlipgyeapsiltysannrsasvripygis
    knsarfefrfpdsssnpylafaailmagmdgvknkidpgeamdinlfkltldeirekgik
    qmphtlrrsleemladkqylkesqvfseefiqayqslkfnaevfpweskphpfefittys
    c
    

    Sequence, based on observed residues (ATOM records): (download)
    >5zlpF (F:)
    nseskikeffefckenevefvdfrfsdikgtwnhiaysfgalthgmlkegipfdascfkg
    wqgiehsdmiltpdlvryfidpfsadvsvvvfcdvydvyknqpyekcprsiakkalqhlk
    dsglgdvayfgaeneffifdsikikdasnsqyyevdseegewnrdrsfengvnfghrpgk
    qggympvpptdtmmdirteivkvlnqvgletfvvhhevaqaqgevgvkfgdlveaadnvq
    klkyvvkmvahlngktatfmpkplygdngsgmhthvsvwknnenlfsgetykglsefalh
    flggvlrharglaaftnastnsykrlipgyeapsiltysannrsasvripygisknsarf
    efrfpdsssnpylafaailmagmdgvknkidpgeamdinlfkltldeirekgikqmphtl
    rrsleemladkqylkesqvfseefiqayqslkfnaevfpweskphpfefittysc
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >5zlpG (G:)
    mivrtqnseskikeffefckenevefvdfrfsdikgtwnhiaysfgalthgmlkegipfd
    ascfkgwqgiehsdmiltpdlvryfidpfsadvsvvvfcdvydvyknqpyekcprsiakk
    alqhlkdsglgdvayfgaeneffifdsikikdasnsqyyevdseegewnrdrsfengvnf
    ghrpgkqggympvpptdtmmdirteivkvlnqvgletfvvhhevaqaqgevgvkfgdlve
    aadnvqklkyvvkmvahlngktatfmpkplygdngsgmhthvsvwknnenlfsgetykgl
    sefalhflggvlrharglaaftnastnsykrlipgyeapsiltysannrsasvripygis
    knsarfefrfpdsssnpylafaailmagmdgvknkidpgeamdinlfkltldeirekgik
    qmphtlrrsleemladkqylkesqvfseefiqayqslkfnaevfpweskphpfefittys
    c
    

    Sequence, based on observed residues (ATOM records): (download)
    >5zlpG (G:)
    qnseskikeffefckenevefvdfrfsdikgtwnhiaysfgalthgmlkegipfdascfk
    gwqgiehsdmiltpdlvryfidpfsadvsvvvfcdvydvyknqpyekcprsiakkalqhl
    kdsglgdvayfgaeneffifdsikikdasnsqyyevdseegewnrdrsfengvnfghrpg
    kqggympvpptdtmmdirteivkvlnqvgletfvvhhevaqaqgevgvkfgdlveaadnv
    qklkyvvkmvahlngktatfmpkplygdngsgmhthvsvwknnenlfsgetykglsefal
    hflggvlrharglaaftnastnsykrlipgyeapsiltysannrsasvripygisknsar
    fefrfpdsssnpylafaailmagmdgvknkidpgeamdinlfkltldeirekgikqmpht
    lrrsleemladkqylkesqvfseefiqayqslkfnaevfpweskphpfefittysc
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >5zlpH (H:)
    mivrtqnseskikeffefckenevefvdfrfsdikgtwnhiaysfgalthgmlkegipfd
    ascfkgwqgiehsdmiltpdlvryfidpfsadvsvvvfcdvydvyknqpyekcprsiakk
    alqhlkdsglgdvayfgaeneffifdsikikdasnsqyyevdseegewnrdrsfengvnf
    ghrpgkqggympvpptdtmmdirteivkvlnqvgletfvvhhevaqaqgevgvkfgdlve
    aadnvqklkyvvkmvahlngktatfmpkplygdngsgmhthvsvwknnenlfsgetykgl
    sefalhflggvlrharglaaftnastnsykrlipgyeapsiltysannrsasvripygis
    knsarfefrfpdsssnpylafaailmagmdgvknkidpgeamdinlfkltldeirekgik
    qmphtlrrsleemladkqylkesqvfseefiqayqslkfnaevfpweskphpfefittys
    c
    

    Sequence, based on observed residues (ATOM records): (download)
    >5zlpH (H:)
    nseskikeffefckenevefvdfrfsdikgtwnhiaysfgalthgmlkegipfdascfkg
    wqgiehsdmiltpdlvryfidpfsadvsvvvfcdvydvyknqpyekcprsiakkalqhlk
    dsglgdvayfgaeneffifdsikikdasnsqyyevdseegewnrdrsfengvnfghrpgk
    qggympvpptdtmmdirteivkvlnqvgletfvvhhevaqaqgevgvkfgdlveaadnvq
    klkyvvkmvahlngktatfmpkplygdngsgmhthvsvwknnenlfsgetykglsefalh
    flggvlrharglaaftnastnsykrlipgyeapsiltysannrsasvripygisknsarf
    efrfpdsssnpylafaailmagmdgvknkidpgeamdinlfkltldeirekgikqmphtl
    rrsleemladkqylkesqvfseefiqayqslkfnaevfpweskphpfefittysc
    

  • Chain 'I':
    Sequence, based on SEQRES records: (download)
    >5zlpI (I:)
    mivrtqnseskikeffefckenevefvdfrfsdikgtwnhiaysfgalthgmlkegipfd
    ascfkgwqgiehsdmiltpdlvryfidpfsadvsvvvfcdvydvyknqpyekcprsiakk
    alqhlkdsglgdvayfgaeneffifdsikikdasnsqyyevdseegewnrdrsfengvnf
    ghrpgkqggympvpptdtmmdirteivkvlnqvgletfvvhhevaqaqgevgvkfgdlve
    aadnvqklkyvvkmvahlngktatfmpkplygdngsgmhthvsvwknnenlfsgetykgl
    sefalhflggvlrharglaaftnastnsykrlipgyeapsiltysannrsasvripygis
    knsarfefrfpdsssnpylafaailmagmdgvknkidpgeamdinlfkltldeirekgik
    qmphtlrrsleemladkqylkesqvfseefiqayqslkfnaevfpweskphpfefittys
    c
    

    Sequence, based on observed residues (ATOM records): (download)
    >5zlpI (I:)
    nseskikeffefckenevefvdfrfsdikgtwnhiaysfgalthgmlkegipfdascfkg
    wqgiehsdmiltpdlvryfidpfsadvsvvvfcdvydvyknqpyekcprsiakkalqhlk
    dsglgdvayfgaeneffifdsikikdasnsqyyevdseegewnrdrsfengvnfghrpgk
    qggympvpptdtmmdirteivkvlnqvgletfvvhhevaqaqgevgvkfgdlveaadnvq
    klkyvvkmvahlngktatfmpkplygdngsgmhthvsvwknnenlfsgetykglsefalh
    flggvlrharglaaftnastnsykrlipgyeapsiltysannrsasvripygisknsarf
    efrfpdsssnpylafaailmagmdgvknkidpgeamdinlfkltldeirekgikqmphtl
    rrsleemladkqylkesqvfseefiqayqslkfnaevfpweskphpfefittysc
    

  • Chain 'J':
    Sequence, based on SEQRES records: (download)
    >5zlpJ (J:)
    mivrtqnseskikeffefckenevefvdfrfsdikgtwnhiaysfgalthgmlkegipfd
    ascfkgwqgiehsdmiltpdlvryfidpfsadvsvvvfcdvydvyknqpyekcprsiakk
    alqhlkdsglgdvayfgaeneffifdsikikdasnsqyyevdseegewnrdrsfengvnf
    ghrpgkqggympvpptdtmmdirteivkvlnqvgletfvvhhevaqaqgevgvkfgdlve
    aadnvqklkyvvkmvahlngktatfmpkplygdngsgmhthvsvwknnenlfsgetykgl
    sefalhflggvlrharglaaftnastnsykrlipgyeapsiltysannrsasvripygis
    knsarfefrfpdsssnpylafaailmagmdgvknkidpgeamdinlfkltldeirekgik
    qmphtlrrsleemladkqylkesqvfseefiqayqslkfnaevfpweskphpfefittys
    c
    

    Sequence, based on observed residues (ATOM records): (download)
    >5zlpJ (J:)
    rtqnseskikeffefckenevefvdfrfsdikgtwnhiaysfgalthgmlkegipfdasc
    fkgwqgiehsdmiltpdlvryfidpfsadvsvvvfcdvydvyknqpyekcprsiakkalq
    hlkdsglgdvayfgaeneffifdsikikdasnsqyyevdseegewnrdrsfengvnfghr
    pgkqggympvpptdtmmdirteivkvlnqvgletfvvhhevaqaqgevgvkfgdlveaad
    nvqklkyvvkmvahlngktatfmpkplygdngsgmhthvsvwknnenlfsgetykglsef
    alhflggvlrharglaaftnastnsykrlipgyeapsiltysannrsasvripygiskns
    arfefrfpdsssnpylafaailmagmdgvknkidpgeamdinlfkltldeirekgikqmp
    htlrrsleemladkqylkesqvfseefiqayqslkfnaevfpweskphpfefittysc
    

  • Chain 'K':
    Sequence, based on SEQRES records: (download)
    >5zlpK (K:)
    mivrtqnseskikeffefckenevefvdfrfsdikgtwnhiaysfgalthgmlkegipfd
    ascfkgwqgiehsdmiltpdlvryfidpfsadvsvvvfcdvydvyknqpyekcprsiakk
    alqhlkdsglgdvayfgaeneffifdsikikdasnsqyyevdseegewnrdrsfengvnf
    ghrpgkqggympvpptdtmmdirteivkvlnqvgletfvvhhevaqaqgevgvkfgdlve
    aadnvqklkyvvkmvahlngktatfmpkplygdngsgmhthvsvwknnenlfsgetykgl
    sefalhflggvlrharglaaftnastnsykrlipgyeapsiltysannrsasvripygis
    knsarfefrfpdsssnpylafaailmagmdgvknkidpgeamdinlfkltldeirekgik
    qmphtlrrsleemladkqylkesqvfseefiqayqslkfnaevfpweskphpfefittys
    c
    

    Sequence, based on observed residues (ATOM records): (download)
    >5zlpK (K:)
    nseskikeffefckenevefvdfrfsdikgtwnhiaysfgalthgmlkegipfdascfkg
    wqgiehsdmiltpdlvryfidpfsadvsvvvfcdvydvyknqpyekcprsiakkalqhlk
    dsglgdvayfgaeneffifdsikikdasnsqyyevdseegewnrdrsfengvnfghrpgk
    qggympvpptdtmmdirteivkvlnqvgletfvvhhevaqaqgevgvkfgdlveaadnvq
    klkyvvkmvahlngktatfmpkplygdngsgmhthvsvwknnenlfsgetykglsefalh
    flggvlrharglaaftnastnsykrlipgyeapsiltysannrsasvripygisknsarf
    efrfpdsssnpylafaailmagmdgvknkidpgeamdinlfkltldeirekgikqmphtl
    rrsleemladkqylkesqvfseefiqayqslkfnaevfpweskphpfefittysc
    

  • Chain 'L':
    Sequence, based on SEQRES records: (download)
    >5zlpL (L:)
    mivrtqnseskikeffefckenevefvdfrfsdikgtwnhiaysfgalthgmlkegipfd
    ascfkgwqgiehsdmiltpdlvryfidpfsadvsvvvfcdvydvyknqpyekcprsiakk
    alqhlkdsglgdvayfgaeneffifdsikikdasnsqyyevdseegewnrdrsfengvnf
    ghrpgkqggympvpptdtmmdirteivkvlnqvgletfvvhhevaqaqgevgvkfgdlve
    aadnvqklkyvvkmvahlngktatfmpkplygdngsgmhthvsvwknnenlfsgetykgl
    sefalhflggvlrharglaaftnastnsykrlipgyeapsiltysannrsasvripygis
    knsarfefrfpdsssnpylafaailmagmdgvknkidpgeamdinlfkltldeirekgik
    qmphtlrrsleemladkqylkesqvfseefiqayqslkfnaevfpweskphpfefittys
    c
    

    Sequence, based on observed residues (ATOM records): (download)
    >5zlpL (L:)
    qnseskikeffefckenevefvdfrfsdikgtwnhiaysfgalthgmlkegipfdascfk
    gwqgiehsdmiltpdlvryfidpfsadvsvvvfcdvydvyknqpyekcprsiakkalqhl
    kdsglgdvayfgaeneffifdsikikdasnsqyyevdseegewnrdrsfengvnfghrpg
    kqggympvpptdtmmdirteivkvlnqvgletfvvhhevaqaqgevgvkfgdlveaadnv
    qklkyvvkmvahlngktatfmpkplygdngsgmhthvsvwknnenlfsgetykglsefal
    hflggvlrharglaaftnastnsykrlipgyeapsiltysannrsasvripygisknsar
    fefrfpdsssnpylafaailmagmdgvknkidpgeamdinlfkltldeirekgikqmpht
    lrrsleemladkqylkesqvfseefiqayqslkfnaevfpweskphpfefittysc