PDB entry 5zli

View 5zli on RCSB PDB site
Description: Crystal structure of glutamine synthetase from helicobacter pylori
Class: ligase
Keywords: glutamine synthetase, enzyme, GS, helicobacter pylori, STRUCTURAL PROTEIN, LIGASE
Deposited on 2018-03-28, released 2018-08-29
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-08-29, with a file datestamp of 2018-08-24.
Experiment type: XRAY
Resolution: 2.8 Å
R-factor: N/A
AEROSPACI score: 0.16 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: glutamine synthetase
    Species: Helicobacter pylori (strain ATCC 700392 / 26695) [TaxId:85962]
    Gene: glnA, HP_0512
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5zlia1, d5zlia2
  • Chain 'B':
    Compound: glutamine synthetase
    Species: Helicobacter pylori (strain ATCC 700392 / 26695) [TaxId:85962]
    Gene: glnA, HP_0512
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5zlib1, d5zlib2
  • Chain 'C':
    Compound: glutamine synthetase
    Species: Helicobacter pylori (strain ATCC 700392 / 26695) [TaxId:85962]
    Gene: glnA, HP_0512
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5zlic1, d5zlic2
  • Chain 'D':
    Compound: glutamine synthetase
    Species: Helicobacter pylori (strain ATCC 700392 / 26695) [TaxId:85962]
    Gene: glnA, HP_0512
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5zlid1, d5zlid2
  • Chain 'E':
    Compound: glutamine synthetase
    Species: Helicobacter pylori (strain ATCC 700392 / 26695) [TaxId:85962]
    Gene: glnA, HP_0512
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5zlie1, d5zlie2
  • Chain 'F':
    Compound: glutamine synthetase
    Species: Helicobacter pylori (strain ATCC 700392 / 26695) [TaxId:85962]
    Gene: glnA, HP_0512
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5zlif1, d5zlif2

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5zliA (A:)
    mivrtqnseskikeffefckenevefvdfrfsdikgtwnhiaysfgalthgmlkegipfd
    ascfkgwqgiehsdmiltpdlvryfidpfsadvsvvvfcdvydvyknqpyekcprsiakk
    alqhlkdsglgdvayfgaeneffifdsikikdasnsqyyevdseegewnrdrsfengvnf
    ghrpgkqggympvpptdtmmdirteivkvlnqvgletfvvhhevaqaqgevgvkfgdlve
    aadnvqklkyvvkmvahlngktatfmpkplygdngsgmhthvsvwknnenlfsgetykgl
    sefalhflggvlrharglaaftnastnsykrlipgyeapsiltysannrsasvripygis
    knsarfefrfpdsssnpylafaailmagmdgvknkidpgeamdinlfkltldeirekgik
    qmphtlrrsleemladkqylkesqvfseefiqayqslkfnaevfpweskphpfefittys
    c
    

    Sequence, based on observed residues (ATOM records): (download)
    >5zliA (A:)
    seskikeffefckenevefvdfrfsdikgtwnhiaysfgalthgmlkegipfdascfkgw
    qgiehsdmiltpdlvryfidpfsadvsvvvfcdvydvyknqpyekcprsiakkalqhlkd
    sglgdvayfgaeneffifdsikikdasnsqyyevdseegewnrdrsfengvnfghrpgkq
    ggympvpptdtmmdirteivkvlnqvgletfvvhhevaqaqgevgvkfgdlveaadnvqk
    lkyvvkmvahlngktatfmpkplygdngsgmhthvsvwknnenlfsgetykglsefalhf
    lggvlrharglaaftnastnsykrlipgyeapsiltysannrsasvripygisknsarfe
    frfpdsssnpylafaailmagmdgvknkidpgeamdinlfkltldeirekgikqmphtlr
    rsleemladkqylkesqvfseefiqayqslkfnaevfpweskphpfefittysc
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5zliB (B:)
    mivrtqnseskikeffefckenevefvdfrfsdikgtwnhiaysfgalthgmlkegipfd
    ascfkgwqgiehsdmiltpdlvryfidpfsadvsvvvfcdvydvyknqpyekcprsiakk
    alqhlkdsglgdvayfgaeneffifdsikikdasnsqyyevdseegewnrdrsfengvnf
    ghrpgkqggympvpptdtmmdirteivkvlnqvgletfvvhhevaqaqgevgvkfgdlve
    aadnvqklkyvvkmvahlngktatfmpkplygdngsgmhthvsvwknnenlfsgetykgl
    sefalhflggvlrharglaaftnastnsykrlipgyeapsiltysannrsasvripygis
    knsarfefrfpdsssnpylafaailmagmdgvknkidpgeamdinlfkltldeirekgik
    qmphtlrrsleemladkqylkesqvfseefiqayqslkfnaevfpweskphpfefittys
    c
    

    Sequence, based on observed residues (ATOM records): (download)
    >5zliB (B:)
    nseskikeffefckenevefvdfrfsdikgtwnhiaysfgalthgmlkegipfdascfkg
    wqgiehsdmiltpdlvryfidpfsadvsvvvfcdvydvyknqpyekcprsiakkalqhlk
    dsglgdvayfgaeneffifdsikikdasnsqyyevdseegewnrdrsfengvnfghrpgk
    qggympvpptdtmmdirteivkvlnqvgletfvvhhevaqaqgevgvkfgdlveaadnvq
    klkyvvkmvahlngktatfmpkplygdngsgmhthvsvwknnenlfsgetykglsefalh
    flggvlrharglaaftnastnsykrlipgyeapsiltysannrsasvripygisknsarf
    efrfpdsssnpylafaailmagmdgvknkidpgeamdinlfkltldeirekgikqmphtl
    rrsleemladkqylkesqvfseefiqayqslkfnaevfpweskphpfefittysc
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >5zliC (C:)
    mivrtqnseskikeffefckenevefvdfrfsdikgtwnhiaysfgalthgmlkegipfd
    ascfkgwqgiehsdmiltpdlvryfidpfsadvsvvvfcdvydvyknqpyekcprsiakk
    alqhlkdsglgdvayfgaeneffifdsikikdasnsqyyevdseegewnrdrsfengvnf
    ghrpgkqggympvpptdtmmdirteivkvlnqvgletfvvhhevaqaqgevgvkfgdlve
    aadnvqklkyvvkmvahlngktatfmpkplygdngsgmhthvsvwknnenlfsgetykgl
    sefalhflggvlrharglaaftnastnsykrlipgyeapsiltysannrsasvripygis
    knsarfefrfpdsssnpylafaailmagmdgvknkidpgeamdinlfkltldeirekgik
    qmphtlrrsleemladkqylkesqvfseefiqayqslkfnaevfpweskphpfefittys
    c
    

    Sequence, based on observed residues (ATOM records): (download)
    >5zliC (C:)
    seskikeffefckenevefvdfrfsdikgtwnhiaysfgalthgmlkegipfdascfkgw
    qgiehsdmiltpdlvryfidpfsadvsvvvfcdvydvyknqpyekcprsiakkalqhlkd
    sglgdvayfgaeneffifdsikikdasnsqyyevdseegewnrdrsfengvnfghrpgkq
    ggympvpptdtmmdirteivkvlnqvgletfvvhhevaqaqgevgvkfgdlveaadnvqk
    lkyvvkmvahlngktatfmpkplygdngsgmhthvsvwknnenlfsgetykglsefalhf
    lggvlrharglaaftnastnsykrlipgyeapsiltysannrsasvripygisknsarfe
    frfpdsssnpylafaailmagmdgvknkidpgeamdinlfkltldeirekgikqmphtlr
    rsleemladkqylkesqvfseefiqayqslkfnaevfpweskphpfefittysc
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >5zliD (D:)
    mivrtqnseskikeffefckenevefvdfrfsdikgtwnhiaysfgalthgmlkegipfd
    ascfkgwqgiehsdmiltpdlvryfidpfsadvsvvvfcdvydvyknqpyekcprsiakk
    alqhlkdsglgdvayfgaeneffifdsikikdasnsqyyevdseegewnrdrsfengvnf
    ghrpgkqggympvpptdtmmdirteivkvlnqvgletfvvhhevaqaqgevgvkfgdlve
    aadnvqklkyvvkmvahlngktatfmpkplygdngsgmhthvsvwknnenlfsgetykgl
    sefalhflggvlrharglaaftnastnsykrlipgyeapsiltysannrsasvripygis
    knsarfefrfpdsssnpylafaailmagmdgvknkidpgeamdinlfkltldeirekgik
    qmphtlrrsleemladkqylkesqvfseefiqayqslkfnaevfpweskphpfefittys
    c
    

    Sequence, based on observed residues (ATOM records): (download)
    >5zliD (D:)
    nseskikeffefckenevefvdfrfsdikgtwnhiaysfgalthgmlkegipfdascfkg
    wqgiehsdmiltpdlvryfidpfsadvsvvvfcdvydvyknqpyekcprsiakkalqhlk
    dsglgdvayfgaeneffifdsikikdasnsqyyevdseegewnrdrsfengvnfghrpgk
    qggympvpptdtmmdirteivkvlnqvgletfvvhhevaqaqgevgvkfgdlveaadnvq
    klkyvvkmvahlngktatfmpkplygdngsgmhthvsvwknnenlfsgetykglsefalh
    flggvlrharglaaftnastnsykrlipgyeapsiltysannrsasvripygisknsarf
    efrfpdsssnpylafaailmagmdgvknkidpgeamdinlfkltldeirekgikqmphtl
    rrsleemladkqylkesqvfseefiqayqslkfnaevfpweskphpfefittysc
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >5zliE (E:)
    mivrtqnseskikeffefckenevefvdfrfsdikgtwnhiaysfgalthgmlkegipfd
    ascfkgwqgiehsdmiltpdlvryfidpfsadvsvvvfcdvydvyknqpyekcprsiakk
    alqhlkdsglgdvayfgaeneffifdsikikdasnsqyyevdseegewnrdrsfengvnf
    ghrpgkqggympvpptdtmmdirteivkvlnqvgletfvvhhevaqaqgevgvkfgdlve
    aadnvqklkyvvkmvahlngktatfmpkplygdngsgmhthvsvwknnenlfsgetykgl
    sefalhflggvlrharglaaftnastnsykrlipgyeapsiltysannrsasvripygis
    knsarfefrfpdsssnpylafaailmagmdgvknkidpgeamdinlfkltldeirekgik
    qmphtlrrsleemladkqylkesqvfseefiqayqslkfnaevfpweskphpfefittys
    c
    

    Sequence, based on observed residues (ATOM records): (download)
    >5zliE (E:)
    seskikeffefckenevefvdfrfsdikgtwnhiaysfgalthgmlkegipfdascfkgw
    qgiehsdmiltpdlvryfidpfsadvsvvvfcdvydvyknqpyekcprsiakkalqhlkd
    sglgdvayfgaeneffifdsikikdasnsqyyevdseegewnrdrsfengvnfghrpgkq
    ggympvpptdtmmdirteivkvlnqvgletfvvhhevaqaqgevgvkfgdlveaadnvqk
    lkyvvkmvahlngktatfmpkplygdngsgmhthvsvwknnenlfsgetykglsefalhf
    lggvlrharglaaftnastnsykrlipgyeapsiltysannrsasvripygisknsarfe
    frfpdsssnpylafaailmagmdgvknkidpgeamdinlfkltldeirekgikqmphtlr
    rsleemladkqylkesqvfseefiqayqslkfnaevfpweskphpfefittysc
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >5zliF (F:)
    mivrtqnseskikeffefckenevefvdfrfsdikgtwnhiaysfgalthgmlkegipfd
    ascfkgwqgiehsdmiltpdlvryfidpfsadvsvvvfcdvydvyknqpyekcprsiakk
    alqhlkdsglgdvayfgaeneffifdsikikdasnsqyyevdseegewnrdrsfengvnf
    ghrpgkqggympvpptdtmmdirteivkvlnqvgletfvvhhevaqaqgevgvkfgdlve
    aadnvqklkyvvkmvahlngktatfmpkplygdngsgmhthvsvwknnenlfsgetykgl
    sefalhflggvlrharglaaftnastnsykrlipgyeapsiltysannrsasvripygis
    knsarfefrfpdsssnpylafaailmagmdgvknkidpgeamdinlfkltldeirekgik
    qmphtlrrsleemladkqylkesqvfseefiqayqslkfnaevfpweskphpfefittys
    c
    

    Sequence, based on observed residues (ATOM records): (download)
    >5zliF (F:)
    seskikeffefckenevefvdfrfsdikgtwnhiaysfgalthgmlkegipfdascfkgw
    qgiehsdmiltpdlvryfidpfsadvsvvvfcdvydvyknqpyekcprsiakkalqhlkd
    sglgdvayfgaeneffifdsikikdasnsqyyevdseegewnrdrsfengvnfghrpgkq
    ggympvpptdtmmdirteivkvlnqvgletfvvhhevaqaqgevgvkfgdlveaadnvqk
    lkyvvkmvahlngktatfmpkplygdngsgmhthvsvwknnenlfsgetykglsefalhf
    lggvlrharglaaftnastnsykrlipgyeapsiltysannrsasvripygisknsarfe
    frfpdsssnpylafaailmagmdgvknkidpgeamdinlfkltldeirekgikqmphtlr
    rsleemladkqylkesqvfseefiqayqslkfnaevfpweskphpfefittysc