PDB entry 5zjp

View 5zjp on RCSB PDB site
Description: Structure of N-acetylmannosamine-6-phosphate-2-epimerase from Vibrio cholerae with N-acetylglucosamine-6-phosphate
Class: isomerase
Keywords: Sialic acid Catabolism Pathway, ISOMERASE
Deposited on 2018-03-21, released 2018-12-05
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-12-05, with a file datestamp of 2018-11-30.
Experiment type: XRAY
Resolution: 2.66 Å
R-factor: N/A
AEROSPACI score: 0.19 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Putative N-acetylmannosamine-6-phosphate 2-epimerase
    Species: Vibrio cholerae [TaxId:666]
    Gene: nanE
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5zjpa_
  • Chain 'B':
    Compound: Putative N-acetylmannosamine-6-phosphate 2-epimerase
    Species: Vibrio cholerae [TaxId:666]
    Gene: nanE
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5zjpb_
  • Heterogens: RFW, PGE, PEG, EDO, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5zjpA (A:)
    knflnieelkrflngqtvvsiqpvtgspldktdfivamaiaveqagakalriegvsnvaa
    vsaavtipiigivkrdlpdspvritpfvsdvdglanagatviafdatnrtrpesreriaq
    aikntgcfamadcstfedglwansqgveivgstlsgyvgdieptvpdfqlvkafseagff
    tmaegryntpelaakaiesgavavtvgsaltrlevvtqwfnnatqaager
    

    Sequence, based on observed residues (ATOM records): (download)
    >5zjpA (A:)
    flnieelkrflngqtvvsiqpvtgspldktdfivamaiaveqagakalriegvsnvaavs
    aavtipiigivkrdlpdspvritpfvsdvdglanagatviafdatnrtrpesreriaqai
    kntgcfamadcstfedglwansqgveivgstlsgyvptvpdfqlvkafseagfftmaegr
    yntpelaakaiesgavavtvgsaltrlevvtqwfnnatqaage
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5zjpB (B:)
    knflnieelkrflngqtvvsiqpvtgspldktdfivamaiaveqagakalriegvsnvaa
    vsaavtipiigivkrdlpdspvritpfvsdvdglanagatviafdatnrtrpesreriaq
    aikntgcfamadcstfedglwansqgveivgstlsgyvgdieptvpdfqlvkafseagff
    tmaegryntpelaakaiesgavavtvgsaltrlevvtqwfnnatqaager