PDB entry 5zjn

View 5zjn on RCSB PDB site
Description: Structure of N-acetylmannosamine-6-phosphate-2-epimerase from Vibrio cholerae with N-acetylmannosamine-6-phosphate
Class: isomerase
Keywords: Sialic acid catabolic pathway Epimerase, ISOMERASE
Deposited on 2018-03-21, released 2018-09-19
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-09-19, with a file datestamp of 2018-09-14.
Experiment type: XRAY
Resolution: 2.66 Å
R-factor: N/A
AEROSPACI score: 0.19 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Putative N-acetylmannosamine-6-phosphate 2-epimerase
    Species: Vibrio cholerae [TaxId:666]
    Gene: nanE
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5zjna_
  • Chain 'B':
    Compound: Putative N-acetylmannosamine-6-phosphate 2-epimerase
    Species: Vibrio cholerae [TaxId:666]
    Gene: nanE
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5zjnb_
  • Heterogens: LRY, PEG, EDO, PGE

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5zjnA (A:)
    mhhhhhhitslykkagfmrknflnieelkrflngqtvvsiqpvtgspldktdfivamaia
    veqagakalriegvsnvaavsaavtipiigivkrdlpdspvritpfvsdvdglanagatv
    iafdatnrtrpesreriaqaikntgcfamadcstfedglwansqgveivgstlsgyvgdi
    eptvpdfqlvkafseagfftmaegryntpelaakaiesgavavtvgsaltrlevvtqwfn
    natqaagerkcah
    

    Sequence, based on observed residues (ATOM records): (download)
    >5zjnA (A:)
    ieelkrflngqtvvsiqpvtgspldktdfivamaiaveqagakalriegvsnvaavsaav
    tipiigivkrdlpdspvritpfvsdvdglanagatviafdatnrtrpesreriaqaiknt
    gcfamadcstfedglwansqgveivgstlsgyvptvpdfqlvkafseagfftmaegrynt
    pelaakaiesgavavtvgsaltrlevvtqwfnnatqaage
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5zjnB (B:)
    mhhhhhhitslykkagfmrknflnieelkrflngqtvvsiqpvtgspldktdfivamaia
    veqagakalriegvsnvaavsaavtipiigivkrdlpdspvritpfvsdvdglanagatv
    iafdatnrtrpesreriaqaikntgcfamadcstfedglwansqgveivgstlsgyvgdi
    eptvpdfqlvkafseagfftmaegryntpelaakaiesgavavtvgsaltrlevvtqwfn
    natqaagerkcah
    

    Sequence, based on observed residues (ATOM records): (download)
    >5zjnB (B:)
    lnieelkrflngqtvvsiqpvtgspldktdfivamaiaveqagakalriegvsnvaavsa
    avtipiigivkrdlpdspvritpfvsdvdglanagatviafdatnrtrpesreriaqaik
    ntgcfamadcstfedglwansqgveivgstlsgyvptvpdfqlvkafseagfftmaegry
    ntpelaakaiesgavavtvgsaltrlevvtqwfnnatqaager