PDB entry 5zjb

View 5zjb on RCSB PDB site
Description: Structure of N-acetylmannosamine-6-phosphate-2-epimerase from Vibrio cholerae
Class: isomerase
Keywords: Sialic acid catabolic pathway Epimerase, ISOMERASE
Deposited on 2018-03-19, released 2018-09-19
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-09-19, with a file datestamp of 2018-09-14.
Experiment type: XRAY
Resolution: 1.7 Å
R-factor: N/A
AEROSPACI score: 0.41 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Putative N-acetylmannosamine-6-phosphate 2-epimerase
    Species: Vibrio mimicus [TaxId:674]
    Gene: nanE, VM_15700
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5zjba_
  • Chain 'B':
    Compound: Putative N-acetylmannosamine-6-phosphate 2-epimerase
    Species: Vibrio mimicus [TaxId:674]
    Gene: nanE, VM_15700
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5zjbb_
  • Heterogens: MLI, PEG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5zjbA (A:)
    mhhhhhhitslykkagfmrknflnieelkrflngqtvvsiqpvtgspldktdfivamaia
    veqagakalriegvsnvaavsaavtipiigivkrdlpdspvritpfvsdvdglanagatv
    iafdatnrtrpesreriaqaikntgcfamadcstfedglwansqgveivgstlsgyvgdi
    eptvpdfqlvkafseagfftmaegryntpelaakaiesgavavtvgsaltrlevvtqwfn
    natqaagerkcah
    

    Sequence, based on observed residues (ATOM records): (download)
    >5zjbA (A:)
    knflnieelkrflngqtvvsiqpvtgspldktdfivamaiaveqagakalriegvsnvaa
    vsaavtipiigivkrdlpdspvritpfvsdvdglanagatviafdatnrtrpesreriaq
    aikntgcfamadcstfedglwansqgveivgstlsgyvgdieptvpdfqlvkafseagff
    tmaegryntpelaakaiesgavavtvgsaltrlevvtqwfnnatqaagerkc
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5zjbB (B:)
    mhhhhhhitslykkagfmrknflnieelkrflngqtvvsiqpvtgspldktdfivamaia
    veqagakalriegvsnvaavsaavtipiigivkrdlpdspvritpfvsdvdglanagatv
    iafdatnrtrpesreriaqaikntgcfamadcstfedglwansqgveivgstlsgyvgdi
    eptvpdfqlvkafseagfftmaegryntpelaakaiesgavavtvgsaltrlevvtqwfn
    natqaagerkcah
    

    Sequence, based on observed residues (ATOM records): (download)
    >5zjbB (B:)
    knflnieelkrflngqtvvsiqpvtgspldktdfivamaiaveqagakalriegvsnvaa
    vsaavtipiigivkrdlpdspvritpfvsdvdglanagatviafdatnrtrpesreriaq
    aikntgcfamadcstfedglwansqgveivgstlsgyvgdieptvpdfqlvkafseagff
    tmaegryntpelaakaiesgavavtvgsaltrlevvtqwfnnatqaagerkc