PDB entry 5ziq

View 5ziq on RCSB PDB site
Description: Crystal structure of hexacoordinated heme protein from anhydrobiotic tardigrade at pH 4
Class: oxygen transport
Keywords: Globin, Tardigrade, UNKNOWN FUNCTION, OXYGEN TRANSPORT
Deposited on 2018-03-16, released 2019-01-02
The last revision prior to the SCOPe 2.07 freeze date was dated 2019-01-02, with a file datestamp of 2018-12-28.
Experiment type: XRAY
Resolution: 1.5 Å
R-factor: N/A
AEROSPACI score: 0.49 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Globin protein
    Species: Ramazzottius varieornatus [TaxId:947166]
    Gene: RvY_09119-1, RvY_09119.1, RvY_09119
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5ziqa1, d5ziqa2
  • Chain 'B':
    Compound: Globin protein
    Species: Ramazzottius varieornatus [TaxId:947166]
    Gene: RvY_09119-1, RvY_09119.1, RvY_09119
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5ziqb1, d5ziqb2
  • Chain 'C':
    Compound: Globin protein
    Species: Ramazzottius varieornatus [TaxId:947166]
    Gene: RvY_09119-1, RvY_09119.1, RvY_09119
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5ziqc1, d5ziqc2
  • Chain 'D':
    Compound: Globin protein
    Species: Ramazzottius varieornatus [TaxId:947166]
    Gene: RvY_09119-1, RvY_09119.1, RvY_09119
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5ziqd_
  • Heterogens: HEM, SO4, EDO, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5ziqA (A:)
    mgsshhhhhhenlyfqsdprfpltardkfslvkswktfsrnlesagkemllklfiehpdm
    kdlfpkfkaktpdqlrndesfeeaalahitpydqavqdsdnvdilltnlkrvgrqhktvp
    gfqesyfermekclvfalqttladaytenmeriykiwiswttekiregfre
    

    Sequence, based on observed residues (ATOM records): (download)
    >5ziqA (A:)
    sdprfpltardkfslvkswktfsrnlesagkemllklfiehpdmkdlfpkfkaktpdqlr
    ndesfeeaalahitpydqavqdsdnvdilltnlkrvgrqhktvpgfqesyfermekclvf
    alqttladaytenmeriykiwiswttekiregfre
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5ziqB (B:)
    mgsshhhhhhenlyfqsdprfpltardkfslvkswktfsrnlesagkemllklfiehpdm
    kdlfpkfkaktpdqlrndesfeeaalahitpydqavqdsdnvdilltnlkrvgrqhktvp
    gfqesyfermekclvfalqttladaytenmeriykiwiswttekiregfre
    

    Sequence, based on observed residues (ATOM records): (download)
    >5ziqB (B:)
    sdprfpltardkfslvkswktfsrnlesagkemllklfiehpdmkdlfpkfkaktpdqlr
    ndesfeeaalahitpydqavqdsdnvdilltnlkrvgrqhktvpgfqesyfermekclvf
    alqttladaytenmeriykiwiswttekiregfre
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >5ziqC (C:)
    mgsshhhhhhenlyfqsdprfpltardkfslvkswktfsrnlesagkemllklfiehpdm
    kdlfpkfkaktpdqlrndesfeeaalahitpydqavqdsdnvdilltnlkrvgrqhktvp
    gfqesyfermekclvfalqttladaytenmeriykiwiswttekiregfre
    

    Sequence, based on observed residues (ATOM records): (download)
    >5ziqC (C:)
    sdprfpltardkfslvkswktfsrnlesagkemllklfiehpdmkdlfpkfkaktpdqlr
    ndesfeeaalahitpydqavqdsdnvdilltnlkrvgrqhktvpgfqesyfermekclvf
    alqttladaytenmeriykiwiswttekiregfre
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >5ziqD (D:)
    mgsshhhhhhenlyfqsdprfpltardkfslvkswktfsrnlesagkemllklfiehpdm
    kdlfpkfkaktpdqlrndesfeeaalahitpydqavqdsdnvdilltnlkrvgrqhktvp
    gfqesyfermekclvfalqttladaytenmeriykiwiswttekiregfre
    

    Sequence, based on observed residues (ATOM records): (download)
    >5ziqD (D:)
    rfpltardkfslvkswktfsrnlesagkemllklfiehpdmkdlfpkfkaktpdqlrnde
    sfeeaalahitpydqavqdsdnvdilltnlkrvgrqhktvpgfqesyfermekclvfalq
    ttladaytenmeriykiwiswttekiregfre