PDB entry 5zim

View 5zim on RCSB PDB site
Description: Crystal structure of bacteriorhodopsin at 1.25 A resolution
Class: proton transport
Keywords: proton pump, membrane protein, PROTON TRANSPORT
Deposited on 2018-03-16, released 2018-10-10
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-10-10, with a file datestamp of 2018-10-05.
Experiment type: XRAY
Resolution: 1.25 Å
R-factor: N/A
AEROSPACI score: 0.61 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: bacteriorhodopsin
    Species: Halobacterium salinarum [TaxId:64091]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5zima_
  • Heterogens: L2P, RET, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5zimA (A:)
    tgrpewiwlalgtalmglgtlyflvkgmgvsdpdakkfyaittlvpaiaftmylsmllgy
    gltmvpfggeqnpiywaryadwlfttplllldlallvdadqgtilalvgadgimigtglv
    galtkvysyrfvwwaistaamlyilyvlffgftskaesmrpevastfkvlrnvtvvlwsa
    ypvvwligsegagivplnietllfmvldvsakvgfglillrsraifge