PDB entry 5zi2

View 5zi2 on RCSB PDB site
Description: MDH3 wild type, nad-form
Class: oxidoreductase
Keywords: Malate dehydrogenase, glyoxysome, fatty acid oxidation, MDH3, OXIDOREDUCTASE
Deposited on 2018-03-14, released 2018-10-24
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-10-24, with a file datestamp of 2018-10-19.
Experiment type: XRAY
Resolution: 2 Å
R-factor: N/A
AEROSPACI score: 0.31 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: malate dehydrogenase
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Gene: MDH3, SCKG_0552
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5zi2a1, d5zi2a2
  • Chain 'B':
    Compound: malate dehydrogenase
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Gene: MDH3, SCKG_0552
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5zi2b1, d5zi2b2
  • Heterogens: GOL, NAD, CL, ADP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5zi2A (A:)
    gsmvkvailgasggvgqplslllklspyvselalydiraaegigkdlshintnsscvgyd
    kdsientlsnaqvvlipagvprkpgltrddlfkmnagivkslvtavgkfapnarilvisn
    pvnslvpiavetlkkmgkfkpgnvmgvtnldlvraetflvdylmlknpkigqeqdkttmh
    rkvtvigghsgetiipiitdkslvfqldkqyehfihrvqfggdeivkakqgagsatlsma
    fagakfaeevlrsfhnekpeteslsafvylpglkngkkaqqlvgdnsieyfslpivlrng
    svvsidtsvleklspreeqlvntavkelrkniekgksfildsskl
    

    Sequence, based on observed residues (ATOM records): (download)
    >5zi2A (A:)
    mvkvailgasggvgqplslllklspyvselalydiraaegigkdlshintnsscvgydkd
    sientlsnaqvvlipagvprkpgltrddlfkmnagivkslvtavgkfapnarilvisnpv
    nslvpiavetlkkmgkfkpgnvmgvtnldlvraetflvdylmlknpkigqeqdkttmhrk
    vtvigghsgetiipiitdkslvfqldkqyehfihrvqfggdeivkakqgagsatlsmafa
    gakfaeevlrsfhnekpeteslsafvylpglkngkkaqqlvgdnsieyfslpivlrngsv
    vsidtsvleklspreeqlvntavkelrkniekgksfild
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5zi2B (B:)
    gsmvkvailgasggvgqplslllklspyvselalydiraaegigkdlshintnsscvgyd
    kdsientlsnaqvvlipagvprkpgltrddlfkmnagivkslvtavgkfapnarilvisn
    pvnslvpiavetlkkmgkfkpgnvmgvtnldlvraetflvdylmlknpkigqeqdkttmh
    rkvtvigghsgetiipiitdkslvfqldkqyehfihrvqfggdeivkakqgagsatlsma
    fagakfaeevlrsfhnekpeteslsafvylpglkngkkaqqlvgdnsieyfslpivlrng
    svvsidtsvleklspreeqlvntavkelrkniekgksfildsskl
    

    Sequence, based on observed residues (ATOM records): (download)
    >5zi2B (B:)
    mvkvailgasggvgqplslllklspyvselalydiraaegigkdlshintnsscvgydkd
    sientlsnaqvvlipagvprkpgltrddlfkmnagivkslvtavgkfapnarilvisnpv
    nslvpiavetlkkmgkfkpgnvmgvtnldlvraetflvdylmlknpkigqeqdkttmhrk
    vtvigghsgetiipiitdkslvfqldkqyehfihrvqfggdeivkakqgagsatlsmafa
    gakfaeevlrsfhnekpeteslsafvylpglkngkkaqqlvgdnsieyfslpivlrngsv
    vsidtsvleklspreeqlvntavkelrkniekgksfild