PDB entry 5zha

View 5zha on RCSB PDB site
Description: Structure of Y68F mutant Mn-Bound periplasmic metal binding protein from candidatus liberibacter asiaticus
Class: metal binding protein
Keywords: ABC transporter, Periplasmic metal binding protein, METAL BINDING PROTEIN
Deposited on 2018-03-12, released 2018-10-03
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-10-03, with a file datestamp of 2018-09-28.
Experiment type: XRAY
Resolution: 1.84 Å
R-factor: N/A
AEROSPACI score: 0.36 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Periplasmic solute binding protein
    Species: Candidatus Liberibacter asiaticus str. psy62 [TaxId:537021]
    Gene: CLIBASIA_02120
    Database cross-references and differences (RAF-indexed):
    • Uniprot C6XF58 (Start-274)
      • engineered mutation (67)
    Domains in SCOPe 2.07: d5zhaa_
  • Heterogens: MN, GOL, ACT, SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5zhaA (A:)
    ttqkkvvlssfsiigditqniakdlvtvttlveagndshsyqvtsadaikiqnadlilcn
    glhleetfmkyftnlkkgtkiitvtdginpigvsedtsvdsepnphawmsltnamiyien
    irkaltaldpsnakkyelnareysekirnsilplktriekvdpekrwfvtsegclvylae
    dfgfkslylwpinsdserspsmmrhainqmrshkikfifsestnsdqpakqvayetnasy
    ggvlyvdslskpdgpaptyldllrfsltkivdtlf
    

    Sequence, based on observed residues (ATOM records): (download)
    >5zhaA (A:)
    kkvvlssfsiigditqniakdlvtvttlveagndshsyqvtsadaikiqnadlilcnglh
    leetfmkyftnlkkgtkiitvtdginpigvsdsepnphawmsltnamiyienirkaltal
    dpsnakkyelnareysekirnsilplktriekvdpekrwfvtsegclvylaedfgfksly
    lwpinrspsmmrhainqmrshkikfifsestnsdqpakqvayetnasyggvlyvdslskp
    dgpaptyldllrfsltkivdtlf