PDB entry 5zfg

View 5zfg on RCSB PDB site
Description: Crystal structure of a diazinon-metabolizing glutathione S-transferase in the silkworm, Bombyx mori
Class: transferase
Keywords: Lepidoptera, Glutathione, Glutathione transferase, Diazinon, TRANSFERASE
Deposited on 2018-03-06, released 2018-09-12
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-09-12, with a file datestamp of 2018-09-07.
Experiment type: XRAY
Resolution: 1.7 Å
R-factor: N/A
AEROSPACI score: 0.4 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: glutathione s-transferase
    Species: Bombyx mori [TaxId:7091]
    Gene: bmgstu2
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5zfga1, d5zfga2
  • Chain 'B':
    Compound: glutathione s-transferase
    Species: Bombyx mori [TaxId:7091]
    Gene: bmgstu2
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5zfgb1, d5zfgb2
  • Heterogens: EDO, ACT, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5zfgA (A:)
    mvlklyavsdgppslsvrqalvalevpfelinvdfgagehmtsdyalmnpqkeipvldde
    gfylsesnailqyicdkyrpgsplypqdpksraivnhrlcfnlssyyanisaytmapiff
    dyertplglkkvhisldvletyltrtntsyaaanhltiadfplinstmtleaidfdfsky
    tkihkwyndfkvkypdlwkisesamkeiqhfaanppdlthlnhpihpirkikn
    

    Sequence, based on observed residues (ATOM records): (download)
    >5zfgA (A:)
    mvlklyavsdgppslsvrqalvalevpfelinvdfgagehmtsdyalmnpqkeipvldde
    gfylsesnailqyicdkyrpgsplypqdpksraivnhrlcfnlssyyanisaytmrtplg
    lkkvhisldvletyltrtntsyaaanhltiadfplinstmtleaidfdfskytkihkwyn
    dfkvkypdlwkisesamkeiqh
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5zfgB (B:)
    mvlklyavsdgppslsvrqalvalevpfelinvdfgagehmtsdyalmnpqkeipvldde
    gfylsesnailqyicdkyrpgsplypqdpksraivnhrlcfnlssyyanisaytmapiff
    dyertplglkkvhisldvletyltrtntsyaaanhltiadfplinstmtleaidfdfsky
    tkihkwyndfkvkypdlwkisesamkeiqhfaanppdlthlnhpihpirkikn
    

    Sequence, based on observed residues (ATOM records): (download)
    >5zfgB (B:)
    mvlklyavsdgppslsvrqalvalevpfelinvdfgagehmtsdyalmnpqkeipvldde
    gfylsesnailqyicdkyrpgsplypqdpksraivnhrlcfnlssyyanisaytmaertp
    lglkkvhisldvletyltrtntsyaaanhltiadfplinstmtleaidfdfskytkihkw
    yndfkvkypdlwkisesamkeiq