PDB entry 5zdi

View 5zdi on RCSB PDB site
Description: Crystal structure of CsaA chaperone protein from picrophilus torridus
Class: chaperone
Keywords: tRNA-binding protein, Chaperone, Thermoacidophiles
Deposited on 2018-02-23, released 2019-02-27
The last revision prior to the SCOPe 2.08 freeze date was dated 2019-02-27, with a file datestamp of 2019-02-22.
Experiment type: XRAY
Resolution: 1.7 Å
R-factor: N/A
AEROSPACI score: 0.41 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Protein secretion chaperonin CsaA
  Species: Picrophilus torridus (strain ATCC 700027 / DSM 9790 / JCM 10055 / NBRC 100828) [TaxId:263820]
  Gene: PTO0409
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q6L208 (0-106)
  Domains in SCOPe 2.08: d5zdia_
• Chain 'B':
  Compound: Protein secretion chaperonin CsaA
  Species: Picrophilus torridus (strain ATCC 700027 / DSM 9790 / JCM 10055 / NBRC 100828) [TaxId:263820]
  Gene: PTO0409
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q6L208 (0-106)
  Domains in SCOPe 2.08: d5zdib_
• Heterogens: GOL, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >5zdiA (A:)
  mityndfskidirvgiikevsdfkeaikpayklkiyfgdiigyknssaqitnykkdelin
  kkiiavvnfppkqianfisevlvlgaitgdgvklltpdggepgdkia
  

  
  
• Chain 'B':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >5zdiB (B:)
  mityndfskidirvgiikevsdfkeaikpayklkiyfgdiigyknssaqitnykkdelin
  kkiiavvnfppkqianfisevlvlgaitgdgvklltpdggepgdkia