PDB entry 5zci

View 5zci on RCSB PDB site
Description: Crystal structure of apo form of Xylose reductase from Debaryomyces nepalensis
Class: oxidoreductase
Keywords: carbohydrate metabolism, aldo-keto reductase, TIM barrel, NADPH dependent, OXIDOREDUCTASE
Deposited on 2018-02-17, released 2018-11-07
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-11-07, with a file datestamp of 2018-11-02.
Experiment type: XRAY
Resolution: 2 Å
R-factor: N/A
AEROSPACI score: 0.32 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: aldose reductase
    Species: Debaryomyces nepalensis [TaxId:27299]
    Gene: Ar
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5zcia_
  • Chain 'B':
    Compound: aldose reductase
    Species: Debaryomyces nepalensis [TaxId:27299]
    Gene: Ar
    Database cross-references and differences (RAF-indexed):
    • Uniprot A0A0M4HL56 (21-340)
      • expression tag (19-20)
    Domains in SCOPe 2.07: d5zcib1, d5zcib2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5zciA (A:)
    mgsshhhhhhssglvprgshmmsiklnsgyemplvgfgcwkvdnatcadtvynaikvgyr
    lfdaamdygnckeigeginraldeglvardelfitsklwnsyhdpknvelalkkvlsdmk
    ldyidlflihfpiafkfvpfeekyppafycgdgdnfhyedvplletwkamekltkggkak
    sigisnfsaaliydllrgaeikpavlqiehhpylqqprlieyvqsqgiaitayssfgpqs
    flelkhskaldtptlfehktitsiadkykktpaqvllrwasqrdiaiipksnnpdrllqn
    levndfnlskedfdeiskldqdlrfnnpwdwdtknripifa
    

    Sequence, based on observed residues (ATOM records): (download)
    >5zciA (A:)
    msiklnsgyemplvgfgcwkvdnatcadtvynaikvgyrlfdaamdygnckeigeginra
    ldeglvardelfitsklwnsyhdpknvelalkkvlsdmkldyidlflihfpiafkfvpfe
    ekyppafycgdgdnfhyedvplletwkamekltkggkaksigisnfsaaliydllrgaei
    kpavlqiehhpylqqprlieyvqsqgiaitayssfgpqsflelkhskaldtptlfehkti
    tsiadkykktpaqvllrwasqrdiaiipksnnpdrllqnlevndfnlskedfdeiskldq
    dlrfnnpwdwdtknripifa
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5zciB (B:)
    mgsshhhhhhssglvprgshmmsiklnsgyemplvgfgcwkvdnatcadtvynaikvgyr
    lfdaamdygnckeigeginraldeglvardelfitsklwnsyhdpknvelalkkvlsdmk
    ldyidlflihfpiafkfvpfeekyppafycgdgdnfhyedvplletwkamekltkggkak
    sigisnfsaaliydllrgaeikpavlqiehhpylqqprlieyvqsqgiaitayssfgpqs
    flelkhskaldtptlfehktitsiadkykktpaqvllrwasqrdiaiipksnnpdrllqn
    levndfnlskedfdeiskldqdlrfnnpwdwdtknripifa
    

    Sequence, based on observed residues (ATOM records): (download)
    >5zciB (B:)
    hmmsiklnsgyemplvgfgcwkvdnatcadtvynaikvgyrlfdaamdygnckeigegin
    raldeglvardelfitsklwnsyhdpknvelalkkvlsdmkldyidlflihfpiafkfvp
    feekyppafycgdgdnfhyedvplletwkamekltkggkaksigisnfsaaliydllrga
    eikpavlqiehhpylqqprlieyvqsqgiaitayssfgpqsflelkhskaldtptlfehk
    titsiadkykktpaqvllrwasqrdiaiipksnnpdrllqnlevndfnlskedfdeiskl
    dqdlrfnnpwdwdtknripifa