PDB entry 5zcb

View 5zcb on RCSB PDB site
Description: Crystal structure of Alpha-glucosidase
Class: hydrolase
Keywords: Alpha-glucosidase, HYDROLASE
Deposited on 2018-02-16, released 2018-12-26
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-12-26, with a file datestamp of 2018-12-21.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: N/A
AEROSPACI score: 0.21 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: alpha-glucosidase
    Species: Bacillus sp. [TaxId:1409]
    Database cross-references and differences (RAF-indexed):
    • PDB 5ZCB (Start-554)
    Domains in SCOPe 2.07: d5zcba1, d5zcba2
  • Heterogens: CA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5zcbA (A:)
    mekkwwkeavayqiyprsfmdsngdgigdiqgviskldylsdlgidviwicpiyqspndd
    ngydisdykdimkdfgtmedfdelldevhhrgmklimdlvinhtsdehpwflesrsaken
    pyrdyyiwhegkdgkepnnwesifsgsawefdektkeyymhvfskkqpdlnwenekvrhe
    lyemvnwwldkgidgfrvdaishikkvagfpdlpnpekldyvpsfeghmnrpgiqehlke
    lkektfakydimtvgeangvtsdsadewvaedggnfnmifqfehmglwdkgeekpldlie
    lktiltnwqnglekingwnalylenhdqirsvnkfgstayrvesakclaalyflmkgtpf
    iyqgqelgmtnvkfdsiddyddvgminyyriqrekgdshdeimkviwetgrdnsrtpmqw
    nteknagfstgnpwmkvnpnyvdinveeqksdknsvlnfykqlikirkqhdvlvygtykl
    laeedsaiyaytrtlegktavvicnmspnnqtfefpsessftnievlihnypldknetle
    qctlhpyetrvylis
    

    Sequence, based on observed residues (ATOM records): (download)
    >5zcbA (A:)
    kwwkeavayqiyprsfmdsngdgigdiqgviskldylsdlgidviwicpiyqspnddngy
    disdykdimkdfgtmedfdelldevhhrgmklimdlvinhtsdehpwflesrsakenpyr
    dyyiwhegkdgkepnnwesifsgsawefdektkeyymhvfskkqpdlnwenekvrhelye
    mvnwwldkgidgfrvdaishikkvagfpdlpnpekldyvpsfeghmnrpgiqehlkelke
    ktfakydimtvgeangvtsdsadewvaedggnfnmifqfehmglwdkpldlielktiltn
    wqnglekingwnalylenhdqirsvnkfgstayrvesakclaalyflmkgtpfiyqgqel
    gmtnvkfdsiddyddvgminyyriqrekgdshdeimkviwetgrdnsrtpmqwnteknag
    fstgnpwmkvnpnyvdinveeqksdknsvlnfykqlikirkqhdvlvygtykllaeedsa
    iyaytrtlegktavvicnmspnnqtfefpssftnievlihnypldknetleqctlhpyet
    rvylis