PDB entry 5zb7

View 5zb7 on RCSB PDB site
Description: CTX-M-64 apoenzyme
Class: hydrolase
Keywords: beta-lactamase, apoenzyme, HYDROLASE
Deposited on 2018-02-10, released 2019-02-13
The last revision prior to the SCOPe 2.07 freeze date was dated 2019-02-13, with a file datestamp of 2019-02-08.
Experiment type: XRAY
Resolution: 1.63 Å
R-factor: N/A
AEROSPACI score: 0.43 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Beta-lactamase
    Species: Escherichia coli [TaxId:562]
    Gene: blaCTX-M-64
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5zb7a_
  • Chain 'B':
    Compound: Beta-lactamase
    Species: Escherichia coli [TaxId:562]
    Gene: blaCTX-M-64
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5zb7b_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5zb7A (A:)
    hhhhhhssglvprgshmasggtelqtadvqqklaelerqsggrlgvalintadnsqilyr
    aderfpmcstskvmaaaavlkqsetqkqllnqpveikpadlvnynpiaekhvngtmtlae
    lsaaalqysdntamnkliaqlggpggvtafaraigdetfrldrteptlntaipgdprdtt
    tpramaqtlrqltlghalgetqraqlvtwlkgnttgaasiraglpaswvvgdktgsggyg
    ttndiaviwpkdraplilvtyftqpqpkaesrrdvlasaakivtdgl
    

    Sequence, based on observed residues (ATOM records): (download)
    >5zb7A (A:)
    advqqklaelerqsggrlgvalintadnsqilyraderfpmcstskvmaaaavlkqsetq
    kqllnqpveikpadlvnynpiaekhvngtmtlaelsaaalqysdntamnkliaqlggpgg
    vtafaraigdetfrldrteptlntaipgdprdtttpramaqtlrqltlghalgetqraql
    vtwlkgnttgaasiraglpaswvvgdktgsggygttndiaviwpkdraplilvtyftqpq
    pkaesrrdvlasaakivtdg
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5zb7B (B:)
    hhhhhhssglvprgshmasggtelqtadvqqklaelerqsggrlgvalintadnsqilyr
    aderfpmcstskvmaaaavlkqsetqkqllnqpveikpadlvnynpiaekhvngtmtlae
    lsaaalqysdntamnkliaqlggpggvtafaraigdetfrldrteptlntaipgdprdtt
    tpramaqtlrqltlghalgetqraqlvtwlkgnttgaasiraglpaswvvgdktgsggyg
    ttndiaviwpkdraplilvtyftqpqpkaesrrdvlasaakivtdgl
    

    Sequence, based on observed residues (ATOM records): (download)
    >5zb7B (B:)
    advqqklaelerqsggrlgvalintadnsqilyraderfpmcstskvmaaaavlkqsetq
    kqllnqpveikpadlvnynpiaekhvngtmtlaelsaaalqysdntamnkliaqlggpgg
    vtafaraigdetfrldrteptlntaipgdprdtttpramaqtlrqltlghalgetqraql
    vtwlkgnttgaasiraglpaswvvgdktgsggygttndiaviwpkdraplilvtyftqpq
    pkaesrrdvlasaakivtdg