PDB entry 5zb5

View 5zb5 on RCSB PDB site
Description: The structural basis of histone chaperoneVps75
Class: chaperone
Keywords: Histone chaperone, acetylation, chaperone
Deposited on 2018-02-09, released 2019-02-13
The last revision prior to the SCOPe 2.07 freeze date was dated 2019-02-13, with a file datestamp of 2019-02-08.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: N/A
AEROSPACI score: 0.25 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: NAP family histone chaperone vps75
    Species: Pneumocystis carinii [TaxId:4754]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5zb5a_
  • Chain 'B':
    Compound: NAP family histone chaperone vps75
    Species: Pneumocystis carinii [TaxId:4754]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5zb5b_
  • Heterogens: PEG, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5zb5A (A:)
    msakktnekrseiqsetnttsldevadielefekadvellkhqvelfnplyekranvlrk
    ipkfwpiaieaapsdelsvyispedanvlehlidlrvyrpnedprdikivfefeaneyle
    snslyleklfryssqkaeasssninkepsqlisekvniewkknkdltrqtkgtapsfftw
    fswtgkendifedeeelaifiaedlypnavkyftdalqeneenedeeidlenengdnise
    eepskkrtkl
    

    Sequence, based on observed residues (ATOM records): (download)
    >5zb5A (A:)
    tsldevadielefekadvellkhqvelfnplyekranvlrkipkfwpiaieaapsdelsv
    yispedanvlehlidlrvyrpnedprdikivfefeaneylesnslyleklfryssqkaea
    nkepsqlisekvniewkknkdltrqtkgtapsfftwfswtgkendifedeeelaifiaed
    lypnavkyftdalqen
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5zb5B (B:)
    msakktnekrseiqsetnttsldevadielefekadvellkhqvelfnplyekranvlrk
    ipkfwpiaieaapsdelsvyispedanvlehlidlrvyrpnedprdikivfefeaneyle
    snslyleklfryssqkaeasssninkepsqlisekvniewkknkdltrqtkgtapsfftw
    fswtgkendifedeeelaifiaedlypnavkyftdalqeneenedeeidlenengdnise
    eepskkrtkl
    

    Sequence, based on observed residues (ATOM records): (download)
    >5zb5B (B:)
    ttsldevadielefekadvellkhqvelfnplyekranvlrkipkfwpiaieaapsdels
    vyispedanvlehlidlrvyrpnedprdikivfefeaneylesnslyleklfryssqkae
    ankepsqlisekvniewkknkdltrapsfftwfswtgkendifedeeelaifiaedlypn
    avkyftdal