PDB entry 5zb4

View 5zb4 on RCSB PDB site
Description: Crystal structure of thymidylate kinase in complex with ADP and TMP from thermus thermophilus HB8
Class: transferase
Keywords: NMP kinase, TRANSFERASE
Deposited on 2018-02-09, released 2018-12-19
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-12-19, with a file datestamp of 2018-12-14.
Experiment type: XRAY
Resolution: 1.92 Å
R-factor: N/A
AEROSPACI score: 0.34 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: thymidylate kinase
    Species: Thermus thermophilus (strain HB8 / ATCC 27634 / DSM 579) [TaxId:300852]
    Gene: tmk, TTHA1607
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5zb4a_
  • Chain 'B':
    Compound: thymidylate kinase
    Species: Thermus thermophilus (strain HB8 / ATCC 27634 / DSM 579) [TaxId:300852]
    Gene: tmk, TTHA1607
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5zb4b_
  • Heterogens: ADP, CA, CL, TMP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5zb4A (A:)
    mpglfltlegldgsgkttqarrlaafleaqgrpvlltrepggglpevrsllltqelspea
    eyllfsadraehvrkvilpglaagkvvisdryldsslayqgygrglplpwlrevareatr
    glkprltflldlppeaalrrvrrpdrleglgleffrrvregylalaraepgrfvvldatl
    peeeiaraiqahlrpllp
    

    Sequence, based on observed residues (ATOM records): (download)
    >5zb4A (A:)
    pglfltlegldgsgkttqarrlaafleaqgrpvlltrepggglpevrsllltqelspeae
    yllfsadraehvrkvilpglaagkvvisdryldsslayqgygrglplpwlrevareatrg
    lkprltflldlppeaaeglgleffrrvregylalaraepgrfvvldatlpeeeiaraiqa
    hlrpll
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5zb4B (B:)
    mpglfltlegldgsgkttqarrlaafleaqgrpvlltrepggglpevrsllltqelspea
    eyllfsadraehvrkvilpglaagkvvisdryldsslayqgygrglplpwlrevareatr
    glkprltflldlppeaalrrvrrpdrleglgleffrrvregylalaraepgrfvvldatl
    peeeiaraiqahlrpllp
    

    Sequence, based on observed residues (ATOM records): (download)
    >5zb4B (B:)
    glfltlegldgsgkttqarrlaafleaqgrpvlltrepggglpevrsllltqelspeaey
    llfsadraehvrkvilpglaagkvvisdryldsslayqgygrglplpwlrevareatrgl
    kprltflldlppeaallgleffrrvregylalaraepgrfvvldatlpeeeiaraiqahl
    rpllp